Property Summary

NCBI Gene PubMed Count 60
PubMed Score 188.27
PubTator Score 96.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
HIV Infections 99
Disease Target Count Z-score Confidence
Cancer 2346 3.523 1.8

Expression

Gene RIF (29)

PMID Text
26614665 Studies indicate a developing focus on targeting eukaryotic initiation factor 4A eIF4A1 and eIF4A2 as cancer therapy.
26113725 eIF4A functions as an adenosine triphosphate-dependent processive helicase when complexed with two accessory proteins, eIF4G and eIF4B.
25866185 Collectively, these data suggested that a potential role of NS4A in antagonizing host antiviral defense is by recruiting eIF4AI and escaping the translation inhibition mediated by PKR.
25779044 demonstrate that DAP5 associates with eIF2beta and eIF4AI to stimulate IRES-dependent translation of cellular mRNAs
25611378 Immunohistochemical analysis was performed on over 3000 breast tumors to investigate the relationship among expression of eIF4A1, the helicase-modulating proteins eIF4B, eIF4E and PDCD4, and clinical outcome.
25320244 Data indicate that caspase recruitment domain family, member 11 protein CARD11 has complex 5'UTRs and is sensitive to eIF4A RNA helicase inhibition.
25079319 report of an eIF4A RNA helicase-dependent mechanism of translational control that contributes to oncogenesis and underlies the anticancer effects of silvestrol and related compounds
24909782 Studies indicate that eukaryotic initiation factor 4AI (EIF4AI) undergoes large conformational transitions, while unwinding RNA hairpins.
24844222 Increased Expression of EIF4A1 is associated with poor response to Brachytherapy in Cervical Cancer.
24471916 The E186 residue was found to be of significance for RNA-dependent ATPase activity for eIF4AI alone and in the presence of eIF4AI-binding domains of eIF4GI, binding between eIF4AI and eIF4GI domains were also significantly influenced by mutation of E186.
24248602 Findings implicate phosphorylation of eIF4G1(Ser1232) by Cdk1:cyclin B and its inhibitory effects on eIF4A helicase activity in the mitotic translation initiation shift.
23747307 Eukaryotic translation initiation factor 4A1 (eIF4A1) is a direct target of miR-US25-2-3p.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 4A1 (EIF4A1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22689062 Regulation of MUC1-C expression is mediated by the PI3K/AKT pathway and the eIF4A RNA helicase.
22589333 The results indicated that eIF4AI and eIF4AII expression are linked and that the two protein isoforms exhibit functional differences.
22076380 study found Burkholderia pseudomallei BPSL1549 acted as a potent cytotoxin against eukaryotic cells; it promotes deamidation of glutamine-339 of the translation initiation factor eIF4A, abolishing its helicase activity and inhibiting translation
21840318 Duplex unwinding and ATPase activities of the DEAD-box helicase eIF4A are coupled by eIF4G and eIF4B.
21454508 analysis of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G
21427765 Studies indicate that eIF4A (DDX2), together with its accessory proteins eIF4B and eIF4H, is thought to act as a helicase that unwinds secondary structures in the mRNA 5' UTR.
21377182 EIF4A and eIF4G proteins are not responsible for the selective translation of viral mRNAs and the translational shut-off of cellular protein synthesis.
20927385 Inhibition of eIF4A reduced the synthesis of APP and tau.
20156963 These findings identify PKP1 as a regulator of translation and proliferation via modulation of eIF4A1 activity.
19203580 Study reports the topology of the eIF4A/4G/4H helicase complex, which is built from multiple experimentally observed domain-domain contacts.
18719248 The interaction of eIF4AI with two accessory factors, eIF4B and eIF4H, was studied.
18296639 the PDCD4 MA3 domains compete with the eIF4G MA3 domain and RNA for eIF4A binding. PDCD4 inhibits translation initiation by displacing eIF4G and RNA from eIF4A.
18034160 Results report that 15d-PGJ2 blocks translation through inactivation of translational initiation factor eIF4A.
17130132 analysis of cells of eIF4GIf molecules lacking either the PABP-binding site, the eIF3-binding site, the middle domain eIF4A-binding site, or the C-terminal segment that includes the second eIF4A-binding site
15082783 Results indicate that not only binding to eIF4A but also prevention of eIF4A binding to the MA-3 domain of eIF4Gc contributes to the mechanism by which Pdcd4 inhibits translation.
11903057 Comparative characterization of two DEAD-box RNA helicases in superfamily II: human translation-initiation factor 4A and hepatitis C virus non-structural protein 3 (NS3) helicase.

AA Sequence

MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGY      1 - 70
DVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV     71 - 140
RAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVV    141 - 210
LLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFIN    211 - 280
TRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLP    281 - 350
TNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI                  351 - 406
//

Text Mined References (74)

PMID Year Title
26614665 2015 Translational dysregulation in cancer: eIF4A isoforms and sequence determinants of eIF4A dependence.
26113725 2015 RNA BIOCHEMISTRY. Factor-dependent processivity in human eIF4A DEAD-box helicase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25866185 2015 Eukaryotic initiation factor 4AI interacts with NS4A of Dengue virus and plays an antiviral role.
25779044 2015 DAP5 associates with eIF2? and eIF4AI to promote Internal Ribosome Entry Site driven translation.
25611378 2015 The malignant phenotype in breast cancer is driven by eIF4A1-mediated changes in the translational landscape.
25320244 2014 Inhibiting CARD11 translation during BCR activation by targeting the eIF4A RNA helicase.
25079319 2014 RNA G-quadruplexes cause eIF4A-dependent oncogene translation in cancer.
24909782 2014 Single-molecule kinetics of the eukaryotic initiation factor 4AI upon RNA unwinding.
24844222 2014 Decreased expression of EIF4A1 after preoperative brachytherapy predicts better tumor-specific survival in cervical cancer.
24471916 2014 Investigation of the conserved glutamate immediately following the DEAD box in eukaryotic translation initiation factor 4AI.
24413684 2014 Tumor suppressor PDCD4 inhibits NF-?B-dependent transcription in human glioblastoma cells by direct interaction with p65.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248602 2014 Mitotic phosphorylation of eukaryotic initiation factor 4G1 (eIF4G1) at Ser1232 by Cdk1:cyclin B inhibits eIF4A helicase complex binding with RNA.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23747307 2013 Over-expression of human cytomegalovirus miR-US25-2-3p downregulates eIF4A1 and inhibits HCMV replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023399 2012 Translational repression precedes and is required for ZAP-mediated mRNA decay.
22689062 2013 Targeting the eIF4A RNA helicase blocks translation of the MUC1-C oncoprotein.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22589333 2012 A cellular response linking eIF4AI activity to eIF4AII transcription.
22076380 2011 A Burkholderia pseudomallei toxin inhibits helicase activity of translation factor eIF4A.
21840318 2011 Duplex unwinding and ATPase activities of the DEAD-box helicase eIF4A are coupled by eIF4G and eIF4B.
21454508 2011 Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor.
21427765 2011 mRNA helicases: the tacticians of translational control.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21377182 2011 Functional impairment of eIF4A and eIF4G factors correlates with inhibition of influenza virus mRNA translation.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20927385 2010 eIF4A inhibition allows translational regulation of mRNAs encoding proteins involved in Alzheimer's disease.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20156963 2010 Plakophilin 1 stimulates translation by promoting eIF4A1 activity.
20133758 2010 Human cytomegalovirus UL69 protein facilitates translation by associating with the mRNA cap-binding complex and excluding 4EBP1.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19204291 2009 Crystal structure of the eIF4A-PDCD4 complex.
19203580 2009 Topology and regulation of the human eIF4A/4G/4H helicase complex in translation initiation.
19153607 2009 Structural basis for translational inhibition by the tumour suppressor Pdcd4.
18719248 2008 Interactions between eIF4AI and its accessory factors eIF4B and eIF4H.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18296639 2008 PDCD4 inhibits translation initiation by binding to eIF4A using both its MA3 domains.
18034160 2007 Anti-inflammatory lipid mediator 15d-PGJ2 inhibits translation through inactivation of eIF4A.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17284590 2007 Cell stress modulates the function of splicing regulatory protein RBM4 in translation control.
17130132 2007 Functional analysis of individual binding activities of the scaffold protein eIF4G.
16932749 2006 p97/DAP5 is a ribosome-associated factor that facilitates protein synthesis and cell proliferation by modulating the synthesis of cell cycle proteins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16166382 2005 Structural basis for the enhancement of eIF4A helicase activity by eIF4G.
15715967 2005 Identification of NOM1, a nucleolar, eIF4A binding protein encoded within the chromosome 7q36 breakpoint region targeted in cases of pediatric acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282546 2004 Exportin 7 defines a novel general nuclear export pathway.
15082783 2004 A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426392 2002 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.
11408474 2001 Eukaryotic initiation factors 4A (eIF4A) and 4G (eIF4G) mutually interact in a 1:1 ratio in vivo.
11073994 2000 Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.
10880459 2000 Adenovirus-specific translation by displacement of kinase Mnk1 from cap-initiation complex eIF4F.
10644445 1999 The human eukaryotic initiation factor 4AI gene (EIF4A1) contains multiple regulatory elements that direct high-level reporter gene expression in mammalian cell lines.
10611228 2000 A novel form of DAP5 protein accumulates in apoptotic cells as a result of caspase cleavage and internal ribosome entry site-mediated translation.
9790779 1998 The linked human elongation initiation factor 4A1 (EIF4A1) and CD68 genes map to chromosome 17p13.
9548260 1998 Interaction of polyadenylate-binding protein with the eIF4G homologue PAIP enhances translation.
9418880 1998 A novel functional human eukaryotic translation initiation factor 4G.
9372926 1997 Human eukaryotic translation initiation factor 4G (eIF4G) possesses two separate and independent binding sites for eIF4A.
9168945 1997 Characterization of the cloned promoter of the human initiation factor 4AI gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8493113 1993 Nucleotide sequence of human cDNA encoding eukaryotic initiation factor 4AI.
8449919 1993 The p46 subunit of eukaryotic initiation factor (eIF)-4F exchanges with eIF-4A.
3215517 1988 Isolation and mapping of a gene for protein synthesis initiation factor 4A and its expression during differentiation of murine erythroleukemia cells.