Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.72
PubTator Score 23.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.281 1.7e-03
Multiple myeloma 1.411 2.9e-03
osteosarcoma -2.635 1.5e-10
hereditary spastic paraplegia -1.012 1.0e-02
tuberculosis and treatment for 3 months -1.100 1.3e-04
primary pancreatic ductal adenocarcinoma -1.031 2.5e-02
Breast cancer 3.300 2.2e-02
ovarian cancer 2.400 1.1e-04
pancreatic cancer -1.100 1.0e-02

Gene RIF (6)

PMID Text
25887626 CK2-phosphorylation of eIF3j at Ser127 promotes the assembly of the eIF3 complex, a crucial step in the activation of the translation initiation machinery.
25246524 eIF1, eIF1A, eIF3j, and the eIF2-GTP-Met-tRNAi ternary complex stably bind to the 43 S preinitiation complex
22804784 whether eIF3alpha polymorphism is associated with severe platinum toxicity in patients with non-small cell lung cancer (NSCLC).
22025682 Beta-Arrestin 2 modulates binding of eIF-3-alpha to selected components of the extracellular signal-regulated kinase pathway.
20060839 a conserved tryptophan residue in the human eIF3j N-terminal acidic motif (NTA) is held in the helix alpha1 and loop 5 hydrophobic pocket of the human eIF3b RNA recognition motif (RRM)
17190833 structural analysis of the eIF3b RNA recognition motif and its interaction with eIF3j

AA Sequence

MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVK      1 - 70
ISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNN     71 - 140
AVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEK    141 - 210
QKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM                          211 - 258
//

Text Mined References (45)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25887626 2015 Protein kinase CK2 potentiates translation efficiency by phosphorylating eIF3j at Ser127.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25246524 2014 Human eukaryotic initiation factor 2 (eIF2)-GTP-Met-tRNAi ternary complex and eIF3 stabilize the 43 S preinitiation complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22804784 2013 Association between eIF3? polymorphism and severe toxicity caused by platinum-based chemotherapy in non-small cell lung cancer patients.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22113938 2011 A bead-based approach for large-scale identification of in vitro kinase substrates.
22025682 2012 Eukaryotic translation initiation factor 3, subunit a, regulates the extracellular signal-regulated kinase pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20060839 2010 The indispensable N-terminal half of eIF3j/HCR1 cooperates with its structurally conserved binding partner eIF3b/PRT1-RRM and with eIF1A in stringent AUG selection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18658124 2008 All translation elongation factors and the e, f, and h subunits of translation initiation factor 3 are encoded by 5'-terminal oligopyrimidine (TOP) mRNAs.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17588516 2007 eIF3j is located in the decoding center of the human 40S ribosomal subunit.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17190833 2007 Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16932749 2006 p97/DAP5 is a ribosome-associated factor that facilitates protein synthesis and cell proliferation by modulating the synthesis of cell cycle proteins.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
15946946 2005 Changes in ribosomal binding activity of eIF3 correlate with increased translation rates during activation of T lymphocytes.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688252 2004 The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11560931 2001 Dual function of eIF3j/Hcr1p in processing 20 S pre-rRNA and translation initiation.
10672017 2000 Changes in integrity and association of eukaryotic protein synthesis initiation factors during apoptosis.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.