Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.15
PubTator Score 24.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.134 8.6e-05
intraductal papillary-mucinous neoplasm ... -1.100 7.9e-03
diabetes mellitus -1.300 1.5e-03
non primary Sjogren syndrome sicca 1.200 2.8e-02
lung adenocarcinoma 1.011 1.3e-08
ovarian cancer 1.900 1.4e-05

Gene RIF (9)

PMID Text
25609201 Clusterin is an independent predictive factor for prognosis of hepatocellular carcinoma and it facilitates metastasis through EIF3I/Akt/MMP13 signaling.
24056964 eIF3i is a proto-oncogene that drives colon oncogenesis by translationally upregulating COX-2 and activating the beta-catenin signaling pathway
22190034 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit I (EIF3I), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit I (EIF3I), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22022972 POLR2J interacts with three different subunits of eIF3, eIF3a, eIF3i, and eIF3m.
21378021 findings report that short hairpin RNA mediated depletion of TRIP-1 gene transcripts in A549 cells promotes epithelial-mesenchymal transition (EMT); knockdown of TRIP-1 dramatically increased A549 responsiveness to TGF-beta1 induction of EMT
19329541 TGF-beta receptor interacting protein 1 (TRIP-1), which we show inhibits fibroblast collagen contraction, is higher in fetal than adult fibroblasts
19059401 Subunit b of the eIF3 complex directly binds to HCV IRES domain III via its N-terminal-RRM.
16929481 eIF3i overexpression fosters the integration of growth signals by mTOR into the mRNA translation process, promoting protein synthesis and tumor growth.

AA Sequence

MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTG      1 - 70
SADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYM     71 - 140
KIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN    141 - 210
TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGR    211 - 280
VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA                             281 - 325
//

Text Mined References (43)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25609201 2015 Clusterin facilitates metastasis by EIF3I/Akt/MMP13 signaling in hepatocellular carcinoma.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24056964 2014 EIF3i promotes colon oncogenesis by regulating COX-2 protein synthesis and ?-catenin activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22022972 2011 A minor isoform of the human RNA polymerase II subunit hRPB11 (POLR2J) interacts with several components of the translation initiation factor eIF3.
21378021 2011 TRIP-1 regulates TGF-?1-induced epithelial-mesenchymal transition of human lung epithelial cell line A549.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19329541 2009 Higher TRIP-1 level explains diminished collagen contraction ability of fetal versus adult fibroblasts.
19059401 2009 Human initiation factor eIF3 subunit b interacts with HCV IRES RNA through its N-terminal RNA recognition motif.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
16929481 2006 Carcinoma-associated eIF3i overexpression facilitates mTOR-dependent growth transformation.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16341674 2005 Transcriptome analysis of human gastric cancer.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14688252 2004 The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11781097 2002 Eukaryotic initiation factor 2 alpha subunit associates with TGF beta receptors and 14-3-3 epsilon and acts as a modulator of the TGF beta response.
10706629 2000 Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9813058 1998 The type II transforming growth factor (TGF)-beta receptor-interacting protein TRIP-1 acts as a modulator of the TGF-beta response.
9599024 1998 Genomic structure and chromosomal location of the human TGFbeta-receptor interacting protein-1 (TRIP-1) gene to 1p34.1.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7566158 1995 Requirement for TFIIH kinase activity in transcription by RNA polymerase II.
7566156 1995 A WD-domain protein that is associated with and phosphorylated by the type II TGF-beta receptor.