Property Summary

NCBI Gene PubMed Count 37
PubMed Score 13.99
PubTator Score 24.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.300 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 7.9e-03
lung adenocarcinoma 1.011 1.3e-08
Multiple myeloma 1.134 8.6e-05
non primary Sjogren syndrome sicca 1.200 2.8e-02
ovarian cancer 1.900 1.4e-05

Gene RIF (10)

AA Sequence

MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTG      1 - 70
SADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYM     71 - 140
KIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN    141 - 210
TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGR    211 - 280
VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA                             281 - 325
//

Text Mined References (45)

PMID Year Title