Property Summary

NCBI Gene PubMed Count 42
PubMed Score 26.86
PubTator Score 20.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.143 3.9e-03
Multiple myeloma 1.648 1.1e-04
lung cancer 1.600 2.2e-04
cystic fibrosis -1.500 3.9e-06
group 4 medulloblastoma -1.100 3.4e-03
nasopharyngeal carcinoma 1.200 1.9e-02
ovarian cancer -1.600 5.1e-05

Synonym

Accession O15372 eIF3h
Symbols EIF3S3
eIF3-p40
eIF3-gamma

Gene

PANTHER Protein Class (1)

PDB

3J8B   3J8C  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

PMID Text
24148822 -RAD21 and EIF3H, both on chromosome 8q23, CHRAC1 on chromosome 8q24.3 and TANC2 on chromosome 17q23-were confirmed to be driver genes regulating the proliferation/survival of clonogenic breast cancer cells
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20862326 Increased expression of EIF3H gene increases colorectal cancer growth and invasiveness thereby providing a biological mechanism for the 8q23.3 association.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20016921 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19204574 MYC and EIF3H are frequently coamplified in NSCLC and that a high copy number correlates with increased epidermal growth factor receptor tyrosine kinase inhibitors sensitivity.
19204574 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18544531 high eIF3h levels directly stimulate protein synthesis, resulting in the establishment and maintenance of the malignant state in cells.
18187620 Knockdown of eukaryotic translation initiation factor 3, subunit H (EIF3H) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16652384 results suggest that eukaryotic translation initiation factor 3, subunit 3 (EIF3S3) regulates cell growth and viability, and that overexpression of the gene may provide growth advantage to the cancer cells
14997205 overexpression of EIF3S3 is associated with breast and prostate cancer
14578863 PTK2 and EIF3S3, which, respectively, encode focal adhesion kinase and the p40 subunit of the eukaryotic initiation factor 3, were probable targets within the amplification at 8q23-q24 and may be involved in progression of HCC.
11733359 Gain of EIF3S3 was associated with poor cancer-specific survival in incidentally found prostate carcinomas.

AA Sequence

MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL      1 - 70
VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY     71 - 140
QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHL    141 - 210
INVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQR    211 - 280
RQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY    281 - 350
NN                                                                        351 - 352
//

Text Mined References (53)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24148822 2014 A siRNA screen identifies RAD21, EIF3H, CHRAC1 and TANC2 as driver genes within the 8q23, 8q24.3 and 17q23 amplicons in breast cancer with effects on cell growth, survival and transformation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21761138 2012 Meta-analysis of new genome-wide association studies of colorectal cancer risk.
21269460 2011 Initial characterization of the human central proteome.
20862326 2010 Allelic variation at the 8q23.3 colorectal cancer risk locus functions as a cis-acting regulator of EIF3H.
20659471 2010 Genetic heterogeneity in colorectal cancer associations between African and European americans.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
19946888 2010 Defining the membrane proteome of NK cells.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19204574 2009 MYC and EIF3H Coamplification significantly improve response and survival of non-small cell lung cancer patients (NSCLC) treated with gefitinib.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18544531 2008 An oncogenic role for the phosphorylated h-subunit of human translation initiation factor eIF3.
18372905 2008 A genome-wide association study identifies colorectal cancer susceptibility loci on chromosomes 10p14 and 8q23.3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16652384 2006 Overexpression of EIF3S3 promotes cancer cell growth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16286006 2005 mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14997205 2004 Expression and copy number analysis of TRPS1, EIF3S3 and MYC genes in breast and prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578863 2003 PTK2 and EIF3S3 genes may be amplification targets at 8q23-q24 and are associated with large hepatocellular carcinomas.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11733359 2001 Amplification of EIF3S3 gene is associated with advanced stage in prostate cancer.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9341143 1997 Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.