Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.16
PubTator Score 8.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25669430 The disease-associated allele increases EIF3G mRNA expression. EIF3G is located in the narcolepsy risk locus and EIF3G expression correlates with PPAN and P2RY11 expression.
24080033 Important roles for eIF3g in the translation initiation machinery and in DNA degradation during apoptosis.
22493286 down-regulation of eIF3g inhibits the efficiency of nonsense-mediated mRNA decay, which is tightly coupled to CT but not to ET
22190034 HIV-1 Pol is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit G (EIF3G) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
17094969 AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein
16243297 Furthermore, we found that overexpression of DISC1 in SH-SY5Y cells induces the assembly of eIF3- and TIA-1-positive stress granules (SGs), discrete cytoplasmic granules formed in response to environmental stresses.

AA Sequence

MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEY      1 - 70
KIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQ     71 - 140
EEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKT    141 - 210
GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSK    211 - 280
GFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN                                  281 - 320
//

Text Mined References (48)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27373335 2016 eIF3 Peripheral Subunits Rearrangement after mRNA Binding and Start-Codon Recognition.
26935993 2016 Nuclear distribution of eIF3g and its interacting nuclear proteins in breast cancer cells.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25669430 2015 EIF3G is associated with narcolepsy across ethnicities.
25416956 2014 A proteome-scale map of the human interactome network.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24080033 2013 Caspase-mediated cleavage and DNase activity of the translation initiation factor 3, subunit G (eIF3g).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22493286 2012 Translation initiation on mRNAs bound by nuclear cap-binding protein complex CBP80/20 requires interaction between CBP80/20-dependent translation initiation factor and eukaryotic translation initiation factor 3g.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347434 2011 Further characterisation of the translational termination-reinitiation signal of the influenza B virus segment 7 RNA.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20406461 2010 Pelota interacts with HAX1, EIF3G and SRPX and the resulting protein complexes are associated with the actin cytoskeleton.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18056426 2007 The mechanism of an exceptional case of reinitiation after translation of a long ORF reveals why such events do not generally occur in mammalian mRNA translation.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17094969 2006 Apoptosis-inducing factor (AIF) inhibits protein synthesis by interacting with the eukaryotic translation initiation factor 3 subunit p44 (eIF3g).
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16243297 2005 A functional link between Disrupted-In-Schizophrenia 1 and the eukaryotic translation initiation factor 3.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
14688252 2004 The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426392 2002 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.
10887144 2000 Protein 4.1R binding to eIF3-p44 suggests an interaction between the cytoskeletal network and the translation apparatus.
9973622 1999 Cloning and characterization of the p42 subunit of mammalian translation initiation factor 3 (eIF3): demonstration that eIF3 interacts with eIF5 in mammalian cells.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.