Property Summary

NCBI Gene PubMed Count 43
PubMed Score 24.48
PubTator Score 20.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.8e-02
oligodendroglioma 1.100 3.2e-09
group 3 medulloblastoma 1.400 2.7e-02
type II diabetes mellitus and post-ische... -1.100 4.0e-02
primitive neuroectodermal tumor 1.200 1.1e-03
diabetes mellitus -1.300 1.1e-03
Breast cancer -1.500 5.3e-12
invasive ductal carcinoma -1.400 1.3e-03
ovarian cancer -2.300 2.2e-07

Gene RIF (11)

PMID Text
26497985 eIF3f/alpha adrenergic receptor interaction
24732644 eIF3f may play an important role in recurrence.
24678890 Decreased expression of eukaryotic initiation factor 3f is associated with gastric cancer.
22457825 findings established a new mechanism of rRNA decay regulation mediated by hnRNP K/eIF3f and suggest that the tumor suppressive function of eIF3f may link to impaired rRNA degradation and translation
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit F (EIF3F) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21124883 catalytically inactive forms of eIF3f as well as shRNAs targeting eIF3f repress Notch activation in a coculture assay, showing that eIF3f is a new positive regulator of the Notch pathway
19854136 eIF3f mediates restriction of HIV-1 expression through a set of factors that includes eIF3f, the SR protein 9G8, and the cyclin-dependent kinase 11 (CDK11).
19245811 eIF3f may inhibit translation by increasing the binding to the eIF3 complex during apoptosis.
19237569 eIF3f specifically interferes with the 3' end processing of HIV-1 mRNAs
18381585 demonstrated a statistically significant decrease of the eIF3f gene copy number in melanoma compared with normal tissues with a tumor/normal ratio of 0.52
17918192 Loss of EIF3F in pancreatic cancer is reported.

AA Sequence

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA      1 - 70
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN     71 - 140
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR    141 - 210
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ    211 - 280
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL    281 - 350
NEKLVNL                                                                   351 - 357
//

Text Mined References (58)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
26497985 2015 The eukaryotic translation initiation factor 3f (eIF3f) interacts physically with the alpha 1B-adrenergic receptor and stimulates adrenoceptor activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25416956 2014 A proteome-scale map of the human interactome network.
24732644 2014 Expression of eukaryotic initiation factor 3f is associated with prognosis in gastric carcinomas.
24678890 2014 Decreased expression of eukaryotic initiation factor 3f is an adverse prognostic factor for stage I-III gastric cancer.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24243016 2013 Gle1 functions during mRNA export in an oligomeric complex that is altered in human disease.
23725059 2013 MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22457825 2012 The tumor suppressive role of eIF3f and its function in translation inhibition and rRNA degradation.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21124883 2010 The translation initiation factor 3f (eIF3f) exhibits a deubiquitinase activity regulating Notch activation.
20800221 2010 Genome-wide association scan of trait depression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
19946888 2010 Defining the membrane proteome of NK cells.
19854136 2009 HIV-1 mRNA 3' end processing is distinctively regulated by eIF3f, CDK11, and splice factor 9G8.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19245811 2009 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
19237569 2009 Inhibition of HIV-1 replication by eIF3f.
18724935 2008 The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18381585 2008 Loss of the eukaryotic initiation factor 3f in melanoma.
18354498 2008 The initiation factor eIF3-f is a major target for atrogin1/MAFbx function in skeletal muscle atrophy.
17918192 2008 Loss of the eukaryotic initiation factor 3f in pancreatic cancer.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16286006 2005 mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446680 2003 The p34cdc2-related cyclin-dependent kinase 11 interacts with the p47 subunit of eukaryotic initiation factor 3 during apoptosis.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9573242 1998 Specific interaction of eukaryotic translation initiation factor 3 with the 5' nontranslated regions of hepatitis C virus and classical swine fever virus RNAs.
9341143 1997 Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.