Property Summary

NCBI Gene PubMed Count 59
PubMed Score 28.05
PubTator Score 42.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.434 8.2e-04
Multiple myeloma 1.787 3.3e-04
lung cancer 1.300 3.1e-04
sonic hedgehog group medulloblastoma 1.200 2.2e-04
ovarian cancer -1.600 2.3e-04

 GWAS Trait (1)

Gene RIF (21)

PMID Text
25400724 High eIF3e expression may contribute to tumor progression and predict poor prognosis in colon cancer.
24736843 40S ribosome loading imparts a phosphorylation mark on the cap-binding eIF4F complex that regulates selective mRNA translation and is synchronized by a specific eIF3 subunit
24481065 Int6/eIF3e is essential for proliferation and survival of human glioblastoma cells.
24092755 eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23478175 IL-6 and IL-8 are HIF2alpha controlled cytokines for angiogenesis particularly in endothelial cells.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22960363 Our findings indicate that Int6 act as a hypoxia-independent master switch of angiogenesis in neuronal cells
22907435 novel role of eIF3e/Int6 in the regulation of EMT in breast epithelial cells
22553336 HTLV-1Tax binds both INT6 and UPF1. The analysis of Tax mutants indicated that the Tax-INT6 association is necessary for nonsense-mediated mRNA decay inhibition, and data suggest that Tax sequesters INT6 out of reach from UPF1.
22532700 INT6 and MIF4GD were observed to colocalize in cytoplasmic foci. It was concluded that INT6, by establishing interactions with MIF4GD and SLBP, plays an important role in translation of poly(A) minus histone mRNAs.
22508697 findings reveal unexpected and striking connections of INT6 with ATM and BRCA1
22190034 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20890303 Int6 depletion blocks ubiquitin-dependent proteolysis by decreasing both ubiquitin levels and the assembly of functional proteasome machinery, leading to accumulation of oncoproteins, such as SRC3.
20453879 data suggest that eIF3e has a positive role in breast cancer progression. It regulates the translation, and in some cases abundance, of mRNAs involved in key aspects of cancer cell biology
17468741 INT6 knockdown by RNA interference strongly inhibits nonsense-mediated messenger RNA decay (NMD), which triggers degradation of mRNAs with premature stop codons.
17310990 INT6 stabilizes chromatin-bound MCM7 and alteration of this effect is associated with replication deficiency.
16766523 eIF3e binds to eIF4G during the process of cap-dependent translation initiation
15867213 Results suggest that Int6 expression, evaluated by quantitative real-time PCR, may represent a new prognostic factor in patients with stage I non-small cell lung cancers.
15558017 Reducing Int-6 expression by RNA interference in HeLa cells markedly alters mitosis progression and defects in spindle formation, chromosome segregation and cytokinesis are observed.
15030549 EIF3e/INT6 is localized in part to the nucleus, while other eIF3 components are cytoplasmic. Primary human fibroblasts showed reduced nuclear INT6 staining in early S phase.
12220626 Int-6 protein can bind the three complexes /eIF3, COP9 signalosome and 26S proteasome/, possibly exerting a regulatory activity in both protein translation and degradation

AA Sequence

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHAL      1 - 70
REKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYE     71 - 140
CGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQ    141 - 210
RTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV    211 - 280
IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC    281 - 350
ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM    351 - 420
NIEKKLNQNSRSEAPNWATQDSGFY                                                 421 - 445
//

Text Mined References (76)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25400724 2014 Overexpression of eIF3e is correlated with colon tumor development and poor prognosis.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24736843 2014 Coupling 40S ribosome recruitment to modification of a cap-binding initiation factor by eIF3 subunit e.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24481065 2014 Int6/eIF3e is essential for proliferation and survival of human glioblastoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24092755 2013 Human eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23478175 2013 Int6/eIF3e silenced HIF2? stabilization enhances migration and tube formation of HUVECs via IL-6 and IL-8 signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22960363 2012 Int6 silencing causes induction of angiogenic factors in neuronal cells via accumulation of hypoxia-inducible factor 2? and decreases brain damage in rats.
22907435 2013 Decreased eIF3e/Int6 expression causes epithelial-to-mesenchymal transition in breast epithelial cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22553336 2012 The human T-lymphotropic virus type 1 tax protein inhibits nonsense-mediated mRNA decay by interacting with INT6/EIF3E and UPF1.
22532700 2012 INT6 interacts with MIF4GD/SLIP1 and is necessary for efficient histone mRNA translation.
22508697 2012 INT6/EIF3E interacts with ATM and is required for proper execution of the DNA damage response in human cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
21732829 2011 Wnt signaling and Dupuytren's disease.
21269460 2011 Initial characterization of the human central proteome.
20890303 2011 Int6 regulates both proteasomal degradation and translation initiation and is critical for proper formation of acini by human mammary epithelium.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20453879 2010 An oncogenic role of eIF3e/INT6 in human breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17761670 2007 Isolation of the Schizosaccharomyces pombe proteasome subunit Rpn7 and a structure-function study of the proteasome-COP9-initiation factor domain.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
17468741 2007 Human INT6/eIF3e is required for nonsense-mediated mRNA decay.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17324924 2007 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17310990 2007 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16973618 2006 Distinct induction patterns and functions of two closely related interferon-inducible human genes, ISG54 and ISG56.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16023166 2005 Induction and mode of action of the viral stress-inducible murine proteins, P56 and P54.
15867213 2005 Int6 expression can predict survival in early-stage non-small cell lung cancer patients.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15558017 2005 Silencing of human Int-6 impairs mitosis progression and inhibits cyclin B-Cdk1 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15030549 2004 Cell cycle-related variation in subcellular localization of eIF3e/INT6 in human fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12553909 2003 Schizosaccharomyces pombe Int6 and Ras homologs regulate cell division and mitotic fidelity via the proteasome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386384 1997 Divergent Subcellular Locations of HTLV-I Tax and Int-6: A Contrast between in vitro Protein-Protein Binding and Intracellular Protein Colocalization.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11590142 2001 The human protein HSPC021 interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
11457827 2001 Saccharomyces cerevisiae protein Pci8p and human protein eIF3e/Int-6 interact with the eIF3 core complex by binding to cognate eIF3b subunits.
11121040 2000 Yin6, a fission yeast Int6 homolog, complexes with Moe1 and plays a role in chromosome segregation.
11118224 2000 A new pathway of translational regulation mediated by eukaryotic initiation factor 3.
10644362 2000 Characterization of the interaction between the interferon-induced protein P56 and the Int6 protein encoded by a locus of insertion of the mouse mammary tumor virus.
10504338 1999 Interaction between the Ret finger protein and the Int-6 gene product and co-localisation into nuclear bodies.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9403073 1997 The chromosome location of the human homolog of the mouse mammary tumor-associated gene INT6 and its status in human breast carcinomas.
9295280 1997 The translation initiation factor eIF3-p48 subunit is encoded by int-6, a site of frequent integration by the mouse mammary tumor virus genome.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8688078 1996 Exclusion of Int-6 from PML nuclear bodies by binding to the HTLV-I Tax oncoprotein.