Property Summary

NCBI Gene PubMed Count 34
PubMed Score 12.50
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.484 4.3e-03
oligodendroglioma 1.100 1.7e-02
medulloblastoma, large-cell 1.200 9.8e-05
acute quadriplegic myopathy 1.633 8.0e-10
primary pancreatic ductal adenocarcinoma -1.262 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.900 1.3e-03
lung cancer 1.100 1.8e-02
diabetes mellitus 2.900 1.6e-03
sonic hedgehog group medulloblastoma 1.400 6.8e-07
mucosa-associated lymphoid tissue lympho... -1.093 9.3e-03
acute myeloid leukemia -1.600 3.4e-02
ovarian cancer 1.900 2.0e-03
pancreatic cancer -1.200 6.6e-04
dermatomyositis 1.300 5.8e-04

Gene RIF (10)

PMID Text
27462815 eIF3d makes specific contacts with the RNA cap, as exemplified by cap analogue competition, and these interactions are essential for assembly of translation initiation complexes on eIF3-specialized mRNAs such as the cell proliferation regulator c-Jun
26617750 Knockdown of eIF3D inhibited breast cancer cell proliferation and invasion.
25682860 EIF3D plays an important role in modulating glioma cell growth and migration.
25370813 Findings suggest that eukaryotic translation initiation factor 3 subunit D (eIF3D) might play an important role in colon cancer progression.
25322666 the critical involvement of EIF3D in the survival and progression of melanoma cells
24092755 eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22190034 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18571626 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYA      1 - 70
YFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKF     71 - 140
QKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRIT    141 - 210
TRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDK    211 - 280
RDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDK    281 - 350
NEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV    351 - 420
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGI    421 - 490
LRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET                491 - 548
//

Text Mined References (52)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27035563 2016 EIF3D silencing suppresses renal cell carcinoma tumorigenesis via inducing G2/M arrest through downregulation of Cyclin B1/CDK1 signaling.
26617750 2015 Knockdown of eIF3D inhibits breast cancer cell proliferation and invasion through suppressing the Wnt/?-catenin signaling pathway.
26036682 2015 The oncogenic role of EIF3D is associated with increased cell cycle progression and motility in prostate cancer.
26008152 2015 Knockdown of eIF3d inhibits cell proliferation through G2/M phase arrest in non-small cell lung cancer.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25682860 2015 RNAi-Mediated Silencing of EIF3D Alleviates Proliferation and Migration of Glioma U251 and U87MG Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25370813 2014 Lentivirus-mediated knockdown of eukaryotic translation initiation factor 3 subunit D inhibits proliferation of HCT116 colon cancer cells.
25322666 Knockdown of EIF3D suppresses proliferation of human melanoma cells through G2/M phase arrest.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24092755 2013 Human eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347434 2011 Further characterisation of the translational termination-reinitiation signal of the influenza B virus segment 7 RNA.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18571626 2008 RASD2, MYH9, and CACNG2 genes at chromosome 22q12 associated with the subgroup of schizophrenia with non-deficit in sustained attention and executive function.
18088087 2008 Phosphoproteome of resting human platelets.
18056426 2007 The mechanism of an exceptional case of reinitiation after translation of a long ORF reveals why such events do not generally occur in mammalian mRNA translation.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12773399 2003 The genome-linked protein VPg of the Norwalk virus binds eIF3, suggesting its role in translation initiation complex recruitment.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590142 2001 The human protein HSPC021 interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
11369516 2001 Inhibition of protein synthesis by the T cell receptor-inducible human TDAG51 gene product.
11331597 2001 Multiple roles for the C-terminal domain of eIF5 in translation initiation complex assembly and GTPase activation.
10591208 1999 The DNA sequence of human chromosome 22.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9573242 1998 Specific interaction of eukaryotic translation initiation factor 3 with the 5' nontranslated regions of hepatitis C virus and classical swine fever virus RNAs.
9341143 1997 Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.