Property Summary

NCBI Gene PubMed Count 42
PubMed Score 65.31
PubTator Score 15.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.179 2.1e-03
astrocytic glioma 1.300 1.3e-02
ependymoma 1.500 2.6e-03
oligodendroglioma 2.000 3.6e-03
psoriasis 1.700 5.7e-05
glioblastoma multiforme 1.400 2.7e-15
osteosarcoma -1.756 1.4e-05
medulloblastoma, large-cell 1.500 1.3e-04
acute quadriplegic myopathy 1.058 1.9e-05
pancreatic ductal adenocarcinoma liver m... 1.638 1.7e-03
non-small cell lung cancer 1.133 2.9e-15
intraductal papillary-mucinous adenoma (... 1.700 1.3e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-03
intraductal papillary-mucinous neoplasm ... 2.200 4.3e-03
colon cancer 1.200 7.7e-05
lung cancer 1.300 3.1e-04
diabetes mellitus -1.100 4.3e-03
group 3 medulloblastoma 1.200 8.8e-03
lung adenocarcinoma 1.020 1.1e-04
gastric carcinoma 1.300 3.4e-02
ovarian cancer 2.300 1.7e-06

 MGI Phenotype (1)

Gene RIF (10)

PMID Text
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
25336651 Novel RNA-binding protein P311 binds eIF3b to promote translation of TGF-beta1, TGF-beta2, TGF-beta3.
25229650 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
24063684 Report EIF3B binding within the IRES domain V of the coxsackie virus B3 mutant strain.
23575475 eIF3b expression relates to human bladder and prostate cancer prognosis, is required for tumor growth, and thus a candidate therapeutic target.
22234522 EIF3B promotes the proliferation of U87 human glioblastoma cells and may play an important role in human glioblastoma development.
22190034 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
20862284 Yeast eIF3b exhibits RNA binding activity but huamn eIF3b doesn't.
20060839 a conserved tryptophan residue in the human eIF3j N-terminal acidic motif (NTA) is held in the helix alpha1 and loop 5 hydrophobic pocket of the human eIF3b RNA recognition motif (RRM)
17190833 structural analysis of the eIF3b RNA recognition motif and its interaction with eIF3j

AA Sequence

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEP      1 - 70
AAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEP     71 - 140
RALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKI    141 - 210
FSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWD    211 - 280
IPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA    281 - 350
TFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC    351 - 420
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIP    421 - 490
ARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVE    491 - 560
MKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS    561 - 630
MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFC    631 - 700
QLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYME    701 - 770
QKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE                              771 - 814
//

Text Mined References (63)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25336651 2014 Novel RNA-binding protein P311 binds eukaryotic translation initiation factor 3 subunit b (eIF3b) to promote translation of transforming growth factor ?1-3 (TGF-?1-3).
24423872 2014 AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24063684 2013 Impaired binding of standard initiation factors eIF3b, eIF4G and eIF4B to domain V of the live-attenuated coxsackievirus B3 Sabin3-like IRES--alternatives for 5'UTR-related cardiovirulence mechanisms.
23575475 2013 Translation initiation factor eIF3b expression in human cancer and its role in tumor growth and lung colonization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22234522 2012 Knockdown of eukaryotic translation initiation factors 3B (EIF3B) inhibits proliferation and promotes apoptosis in glioblastoma cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21986499 2011 PHLPP-mediated dephosphorylation of S6K1 inhibits protein translation and cell growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347434 2011 Further characterisation of the translational termination-reinitiation signal of the influenza B virus segment 7 RNA.
21269460 2011 Initial characterization of the human central proteome.
20862284 2010 Crystal structure of the RNA recognition motif of yeast translation initiation factor eIF3b reveals differences to human eIF3b.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20060839 2010 The indispensable N-terminal half of eIF3j/HCR1 cooperates with its structurally conserved binding partner eIF3b/PRT1-RRM and with eIF1A in stringent AUG selection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19245811 2009 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18423201 2008 SKAR links pre-mRNA splicing to mTOR/S6K1-mediated enhanced translation efficiency of spliced mRNAs.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18056426 2007 The mechanism of an exceptional case of reinitiation after translation of a long ORF reveals why such events do not generally occur in mammalian mRNA translation.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17468741 2007 Human INT6/eIF3e is required for nonsense-mediated mRNA decay.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17190833 2007 Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
16286006 2005 mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15567442 2004 Proteomics of herpes simplex virus infected cell protein 27: association with translation initiation factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688252 2004 The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11457827 2001 Saccharomyces cerevisiae protein Pci8p and human protein eIF3e/Int-6 interact with the eIF3 core complex by binding to cognate eIF3b subunits.
11331597 2001 Multiple roles for the C-terminal domain of eIF5 in translation initiation complex assembly and GTPase activation.
11169732 2001 Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7.
9847074 1998 Toward a complete human genome sequence.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9573242 1998 Specific interaction of eukaryotic translation initiation factor 3 with the 5' nontranslated regions of hepatitis C virus and classical swine fever virus RNAs.
9388245 1997 Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7693677 1993 Characterization of an interleukin-2 (IL-2)-induced tyrosine phosphorylated 116-kDa protein associated with the IL-2 receptor beta-subunit.