Property Summary

NCBI Gene PubMed Count 78
PubMed Score 174.76
PubTator Score 297.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.624 8.6e-04
osteosarcoma -1.517 1.8e-04
astrocytoma 1.100 9.0e-03
medulloblastoma, large-cell 1.600 1.3e-04
hereditary spastic paraplegia -1.194 8.3e-03
Amyotrophic Lateral Sclerosis 1.063 9.8e-06
acute quadriplegic myopathy 1.406 5.1e-06
group 3 medulloblastoma 1.100 1.1e-02
ovarian cancer 2.500 2.2e-07
dermatomyositis 1.100 1.2e-03

Gene RIF (39)

PMID Text
26213845 eIF3a improves ovarian cancer patients' response to cisplatin-based chemotherapy by down regulating XPC and p27(Kip1).
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
25898924 Collybistin forms a complex with mTOR and eIF3 and by sequestering these proteins downregulates mTORC1 signaling and protein synthesis potentially contributing to intellectual disability and autism.
25732572 eIF3a SNPs are significantly correlated with platinum-based chemotherapy toxicities in Chinese non-small cell lung carcinoma patients.
25509353 At 37 degrees C, P185(HER2) internalized through coated pits and vesicles and concentrated in the endosomes and multivesicular bodies in the cells of both cell lines, as well as in lysosomes in cells BT-474
25070653 Data conclude that eIF3a expression may have a profound effect on the urinary bladder cancer phenotype and, in addition, may serve as a prognostic marker for low grade UBCs.
24912683 eIF3a and eIF3c control abundance and assembly of the entire eIF3 and thus represent its crucial scaffolding elements critically required for formation of preinitiation complexes.
24789280 findings suggested altered eIF3a expression closely correlated with p27 status, and the association was of prognostic value for resected NSCLC
24396066 The Paip1-eIF3 interaction is impaired by the mTORC1 inhibitors.
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
24320561 The correct folding of subunits of translation initiation factor eIF3 is mediated by interaction with chaperonin containing TCP-1 (CCT).
24250809 Taken together, these results show that Neurospora crassa eIF3 provides a tractable system for probing the structure and function of human-like eIF3 in the context of living cells.
23921387 eukaryotic initiation factor 3a spectrin domain is the docking site for formation of the a:b:i:g subcomplex
23766293 Mutations in the RNA-binding motif of subunit eIF3a weaken eIF3 binding to the HCV IRES and the 40S ribosomal subunit, thereby suppressing eIF2-dependent recognition of the start codon.
23623729 results highlight the conserved architecture of eIF3 and how it scaffolds key factors that control translation initiation in higher eukaryotes, including humans
23530232 MLN51, alone or as part of the EJC, interacts directly with the pivotal eukaryotic translation initiation factor eIF3
23437357 NDRG1 is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
23393223 eIF3a regulates RPA2 synthesis by regulating its internal ribosome entry site activity
23127338 Lung cancer patients carrying rs3740556 A allele tended to have a favorable prognosis after treatment with platinum-based chemotherapy.
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit A of eukaryotic translation initiation factor 3 (EIF3A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22634302 Iron promotes the translation initiation of hepatitis C virus by stimulating the expression of eIF3A and La proteins.
22190034 Tandem affinity purification and mass spectrometry analysis identify subunit A of eukaryotic translation initiation factor 3 (EIF3A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22022972 POLR2J interacts with three different subunits of eIF3, eIF3a, eIF3i, and eIF3m.
21625209 conclude that eIF3a has an important role in the CDDP response and in NER activity of NPCs by suppressing the synthesis of NER proteins
21610145 eIF3a plays an important role in regulating the expression of DNA repair proteins.
20818067 Docetaxel could slightly increase the expression of eIF3a mRNA, and eIF3a does not regulate the expression of alpha-tubulin in A549 cells.
20647036 some studies have identified eIF3a to be involved in cancer development, while other results indicate that it could provide protection against evolution into higher malignancy.[review]
20399188 analysis of the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19327350 eIF3a expression oscillated with cell cycle and peaked in S phase. Reducing eIF3a expression also reduced cell proliferation rate by elongating cell cycle but did not change the cell cycle distribution.
18725400 eIF3-Paip1 stabilizes the interaction between PABP and eIF4G, which brings about the circularization of the mRNA.
18599441 interaction map allows comparison of free eIF3 with that bound to the hepatitis C virus internal ribosome entry site (HCV-IRES) RNA
18568671 was no difference in the expression of EGFR, p185(erbB-2) or Bcl-2, or in nuclear accumulation of p53 in these IDC from pre- vs. post-menopausal women.
17581632 Extensive deletion analyses suggest that three evolutionarily conserved subunits (eIF3a, eIF3b, and eIF3c) and three non-conserved subunits (eIF3e, eIF3f, and eIF3h) comprise the functional core of mammalian eIF3.
17381544 May play some roles in development and differentiation; decreased eIF3a expression may be a pre-requisite of intestinal epithelial cell differentiation.
16829125 REVIEW of roles of subunits of eIF3 in regulating translation of specific mRNAs encoding proteins important for cell growth control, and how altered expression may cause cancer and/or affect prognosis
16497727 Consequently, eIF3c appears to be involved in NF2 pathogenesis and deserves to be investigated as a prognostic marker for NF2 and target for treatment of NF2 patient tumors
16385451 Observational study of gene-disease association. (HuGE Navigator)
15946946 The complex formation of eIF3 and its association with the ribosomes might contribute to increased translation rates during T lymphocyte activation.

AA Sequence

MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEG      1 - 70
LYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR     71 - 140
TDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQR    141 - 210
HHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVS    211 - 280
TVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVE    281 - 350
KQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK    351 - 420
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRT    421 - 490
LSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKN    491 - 560
SRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQ    561 - 630
IKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFER    631 - 700
AKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQS    701 - 770
VYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE    771 - 840
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWR    841 - 910
RGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRR    911 - 980
GADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRR    981 - 1050
GGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPW   1051 - 1120
RNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWG   1121 - 1190
PPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWR   1191 - 1260
DSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRV   1261 - 1330
PPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR                     1331 - 1382
//

Text Mined References (92)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
26213845 2015 eIF3a improve cisplatin sensitivity in ovarian cancer by regulating XPC and p27Kip1 translation.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898924 2016 Collybistin binds and inhibits mTORC1 signaling: a potential novel mechanism contributing to intellectual disability and autism.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25732572 2015 Association of positively selected eIF3a polymorphisms with toxicity of platinum-based chemotherapy in NSCLC patients.
25509353 [Immunocytochemical visualization of P185(HER2) receptor by antibody fused with dibarnase and conjugate of barstar with colloidal gold].
25070653 2014 eIF3a is over-expressed in urinary bladder cancer and influences its phenotype independent of translation initiation.
24912683 2014 Functional and biochemical characterization of human eukaryotic translation initiation factor 3 in living cells.
24789280 2014 The prognostic value of altered eIF3a and its association with p27 in non-small cell lung cancers.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24357634 2014 The mechanism of translation initiation on Type 1 picornavirus IRESs.
24320561 2014 The chaperonin CCT interacts with and mediates the correct folding and activity of three subunits of translation initiation factor eIF3: b, i and h.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24250809 2013 Human-like eukaryotic translation initiation factor 3 from Neurospora crassa.
23921387 2013 Spectrin domain of eukaryotic initiation factor 3a is the docking site for formation of the a:b:i:g subcomplex.
23766293 2013 Two RNA-binding motifs in eIF3 direct HCV IRES-dependent translation.
23623729 2013 Architecture of human translation initiation factor 3.
23530232 2013 EJC core component MLN51 interacts with eIF3 and activates translation.
23437357 2013 N-myc downstream regulated 1 (NDRG1) is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
23393223 2013 Translational regulation of RPA2 via internal ribosomal entry site and by eIF3a.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127338 2013 The A/G allele of eIF3a rs3740556 predicts platinum-based chemotherapy resistance in lung cancer patients.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22634302 2012 Regulation of hepatitis C virus translation initiation by iron: role of eIF3 and La protein.
22190034 2011 Global landscape of HIV-human protein complexes.
22022972 2011 A minor isoform of the human RNA polymerase II subunit hRPB11 (POLR2J) interacts with several components of the translation initiation factor eIF3.
21625209 2011 Role of eIF3a in regulating cisplatin sensitivity and in translational control of nucleotide excision repair of nasopharyngeal carcinoma.
21610145 2011 Effect of eIF3a on response of lung cancer patients to platinum-based chemotherapy by regulating DNA repair.
21347434 2011 Further characterisation of the translational termination-reinitiation signal of the influenza B virus segment 7 RNA.
21269460 2011 Initial characterization of the human central proteome.
20818067 2010 Effect of docetaxel on expression of eIF3a in human lung cancer A549 cell line.
20647036 2010 The translational regulator eIF3a: the tricky eIF3 subunit!
20399188 2010 Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19327350 2009 Role of eIF3a in regulating cell cycle progression.
19245811 2009 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
18725400 2008 Poly(A)-binding protein-interacting protein 1 binds to eukaryotic translation initiation factor 3 to stimulate translation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18568671 2008 Immunohistochemical detection of EGFR, p185(erbB-2), Bcl-2 and p53 in breast carcinomas in pre-menopausal and post-menopausal women.
18423202 2008 Upf1 phosphorylation triggers translational repression during nonsense-mediated mRNA decay.
18056426 2007 The mechanism of an exceptional case of reinitiation after translation of a long ORF reveals why such events do not generally occur in mammalian mRNA translation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17468741 2007 Human INT6/eIF3e is required for nonsense-mediated mRNA decay.
17381544 2007 Role of eIF3a (eIF3 p170) in intestinal cell differentiation and its association with early development.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
16829125 2006 Initiation factor eIF3 and regulation of mRNA translation, cell growth, and cancer.
16766523 2006 Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.
16763566 2006 The mTOR/PI3K and MAPK pathways converge on eIF4B to control its phosphorylation and activity.
16497727 2006 Schwannomin inhibits tumorigenesis through direct interaction with the eukaryotic initiation factor subunit c (eIF3c).
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
15946946 2005 Changes in ribosomal binding activity of eIF3 correlate with increased translation rates during activation of T lymphocytes.
15703437 2005 Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688252 2004 The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro.
14519125 2003 Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
11384103 2001 Identification of a 170-kDa protein over-expressed in lung cancers.
11169732 2001 Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
10611228 2000 A novel form of DAP5 protein accumulates in apoptotic cells as a result of caspase cleavage and internal ribosome entry site-mediated translation.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
9925932 1998 Assignment1 of the p150 subunit of the eukaryotic initiation factor 3A gene (EIF3A) to human chromosome band 10q26 by in situ hybridisation.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9573242 1998 Specific interaction of eukaryotic translation initiation factor 3 with the 5' nontranslated regions of hepatitis C virus and classical swine fever virus RNAs.
9150439 1997 The human p167 gene encodes a unique structural protein that contains centrosomin A homology and associates with a multicomponent complex.
9054404 1997 Identification of cDNA clones for the large subunit of eukaryotic translation initiation factor 3. Comparison of homologues from human, Nicotiana tabacum, Caenorhabditis elegans, and Saccharomyces cerevisiae.
8995410 1997 The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170.
8995409 1997 Conservation and diversity of eukaryotic translation initiation factor eIF3.
8816444 1996 A region rich in aspartic acid, arginine, tyrosine, and glycine (DRYG) mediates eukaryotic initiation factor 4B (eIF4B) self-association and interaction with eIF3.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.
2110361 1990 Monoclonal antibodies to individual tyrosine-phosphorylated protein substrates of oncogene-encoded tyrosine kinases.