Property Summary

NCBI Gene PubMed Count 46
PubMed Score 11.32
PubTator Score 95.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 1.4e-06
ovarian cancer 8520 1.3e-05
lung cancer 4740 1.2e-03
Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0
Disease Target Count Z-score Confidence
Biotinidase deficiency 14 3.743 1.9
Glycine encephalopathy 29 3.216 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 1.2e-03
osteosarcoma -1.380 1.4e-06
ovarian cancer 1.400 1.3e-05

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQ      1 - 70
VGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSG     71 - 140
VKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRL    141 - 210
GLQYSQGLVSGSNARCIALLRALQQVIQDYTTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFL    211 - 280
NKEITSVGSSKREEEAKSELRAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAW    281 - 350
TEGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT    351 - 420
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHASLRLLNLVYD    421 - 490
VTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ                                         491 - 523
//

Text Mined References (55)

PMID Year Title