Property Summary

NCBI Gene PubMed Count 40
PubMed Score 32.18
PubTator Score 19.17

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTA      1 - 70
AQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINEL     71 - 140
LVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKA    141 - 210
GIETTVMTDAAIFAVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPN    211 - 280
EEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHV    281 - 350
L//

Text Mined References (42)

PMID Year Title