Property Summary

NCBI Gene PubMed Count 34
PubMed Score 23.68
PubTator Score 13.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 3.6e-02
lung cancer 1.400 1.9e-03
ovarian cancer 2.400 6.1e-06

Gene RIF (11)

PMID Text
26112719 Oligodendrocytes with truncated or deletion mutants eIF2B showed less tolerable to endoplasmic reticulum stress
21795329 These data emphasize the importance of eIF2Balpha in mediating the eIF2 kinase translation-inhibitory activity and may provide insight into the complex nature of vesiculovirus oncolysis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19631657 Crystal structure of the alpha subunit of human translation initiation factor 2B.
18632786 Observational study of gene-disease association. (HuGE Navigator)
18330844 The authors suspected VWM and sequenced the genes EIF2B1-5, which revealed one heterozygous mutation in EIF2B4.
18263758 Study reports 9 novel mutations in EIF2B genes in 8 patients, increasing number of known mutations to more than 120. Using homology modeling, analyzed the impact of novel mutations on the 5 subunits of eIF2B protein (alpha, beta, gamma, delta, epsilon)
15776425 analysis of novel mutations in patients with eIF2B-related disorders
14993275 Biochemical analyses indicate that mutations analyzed in eIF2Balpha and -epsilon reduce the steady-state level of the affected subunit, while the most severe mutant tested, eIF2Bbeta(V341D), forms complexes with reduced stability and lower eIF2B activity.
14566705 mutational analysis of the eIF2B genes of patients with an antenatal- or early-infantile-onset encephalopathy and an early demise

AA Sequence

MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGE      1 - 70
LFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEA     71 - 140
AVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKI    141 - 210
GTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSL    211 - 280
ITLLFTDLGVLTPSAVSDELIKLYL                                                 281 - 305
//

Text Mined References (38)

PMID Year Title
26112719 2015 Different Eukaryotic Initiation Factor 2B? Mutations Lead to Various Degrees of Intolerance to the Stress of Endoplasmic Reticulum in Oligodendrocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21795329 2011 The alpha subunit of eukaryotic initiation factor 2B (eIF2B) is required for eIF2-mediated translational suppression of vesicular stomatitis virus.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19631657 2009 Crystal structure of the alpha subunit of human translation initiation factor 2B.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18632786 2008 No evidence that polymorphisms of the vanishing white matter disease genes are risk factors in multiple sclerosis.
18330844 2007 Conversion of a normal MRI into an MRI showing a cystic leukoencephalopathy is not a known feature of vanishing white matter.
18263758 2008 Genetic and clinical heterogeneity in eIF2B-related disorder.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289705 2006 An efficient mammalian cell-free translation system supplemented with translation factors.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15776425 2005 Identification of ten novel mutations in patients with eIF2B-related disorders.
15752756 2005 Identification of novel CBP interacting proteins in embryonic orofacial tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217090 2004 The life and death of oligodendrocytes in vanishing white matter disease.
15060152 2004 Mutations linked to leukoencephalopathy with vanishing white matter impair the function of the eukaryotic initiation factor 2B complex in diverse ways.
14993275 2004 Mutations causing childhood ataxia with central nervous system hypomyelination reduce eukaryotic initiation factor 2B complex formation and activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14566705 2003 eIF2B-related disorders: antenatal onset and involvement of multiple organs.
12707859 2003 Ovarian failure related to eukaryotic initiation factor 2B mutations.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11835386 2002 Mutations in each of the five subunits of translation initiation factor eIF2B can cause leukoencephalopathy with vanishing white matter.
11323413 2001 Characterization of the mammalian initiation factor eIF2B complex as a GDP dissociation stimulator protein.
10858531 2000 Identification of domains within the epsilon-subunit of the translation initiation factor eIF2B that are necessary for guanine nucleotide exchange activity and eIF2B holoprotein formation.
10805739 2000 Identification of domains and residues within the epsilon subunit of eukaryotic translation initiation factor 2B (eIF2Bepsilon) required for guanine nucleotide exchange reveals a novel activation function promoted by eIF2B complex formation.
9446619 1998 Identification of interprotein interactions between the subunits of eukaryotic initiation factors eIF2 and eIF2B.
9235896 1997 A novel interaction between adrenergic receptors and the alpha-subunit of eukaryotic initiation factor 2B.
8887689 1996 Identification of a regulatory subcomplex in the guanine nucleotide exchange factor eIF2B that mediates inhibition by phosphorylated eIF2.
8626696 1996 T-cell activation leads to rapid stimulation of translation initiation factor eIF2B and inactivation of glycogen synthase kinase-3.
7495858 1995 Structure and sequence of the gene encoding the alpha-subunit of rat translation initiation factor-2B.
1883206 1991 Translational control in mammalian cells.