Property Summary

NCBI Gene PubMed Count 115
PubMed Score 806.39
PubTator Score 585.89

Knowledge Summary

Patent (30,266)

Expression

  Differential Expression (6)

Disease log2 FC p
chronic lymphosyte leukemia -1.900 2.4e-08
psoriasis 2.300 3.5e-04
osteosarcoma 1.731 1.4e-05
acute quadriplegic myopathy 1.075 8.4e-06
intraductal papillary-mucinous neoplasm ... -1.200 2.1e-03
ovarian cancer 2.500 9.7e-06

Protein-protein Interaction (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1416 screening 370 / 0 / 217747 Primary cell-based high-throughput screening assay to measure PERK inhibition
1522 confirmatory 0 / 0 / 118 Dose response cell-based high-throughput screening assay to measure PERK inhibition
1528 confirmatory 0 / 0 / 118 Counterscreen assay for PERK inhibitors: Dose response cell-based high throughput screening assay to measure inhibition of PERK at 6 hours
1842 summary 0 / 0 / 10 Summary of probe development efforts to identify inhibitors of RNA-dependent protein kinase (PKR)-like ER kinase (PERK)

Gene RIF (91)

PMID Text
26642955 This study demonstrates a new role for CREB as a regulator of ER stress, which is required to properly respond to stressful conditions, such as hypoxia.
26634309 Using drugs that specifically inhibit or activate the PERK or IRE1alpha sensors, we demonstrate that signalling through the PERK axis activates this expression, through a transcriptional mechanism
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26446798 Nitric oxide can S-nitrosylate the endoplasmic reticulum stress sensors IRE1alapha and PERK.
26279443 In human alveolar epithelial A549 cells, Lipopolysaccharide induces autophagic cell death that depends on the activation of the PERK branch of the unfolded protein response upon endoplasmic reticulum (ER) stress .
26259235 CGK733-induced intracellular calcium sequestration in pancreatic tumor cells is correlated with the PERK/CHOP signaling pathway and may also be involved in the dysregulations of calcium-binding proteins.
26225772 In this review, we particularly focused on the novel, intriguing and complicated role of PERK in ER stress-decided cell fate, and also discussed more roles of PERK in restoring cellular homeostasis
26078722 PERK-activated osteosarcomatous autophagy via inhibition of the mTORC1 pathway prevents cell apoptosis.
25976933 These results confirm that HIV infection activates stress-response components and that antiretroviral therapy contributes to changes in the unfolded protein response activation profile.
25925385 interface mutations that disrupt tetramer formation in vitro reduce phosphorylation of PERK and its target eIF2alpha in cells.
25761777 Our results reveal that PERK activation is involved in glioma glycolysis regulation and may be a potential molecular target for glioma treatment.
25692299 discover that BiP is dual functional UPR sensor, sensing unfolded proteins by canonical binding to substrates and transducing this event to noncanonical, signaling interaction to Ire1 and Perk
25675914 ER stress-induced apoptosis was important in the development of SPE, especially in early onset SPE and was probably due to the activation of the PERK signaling pathway.
25633195 Data indicated that the relative timing of IRE1 and PERK signalling determines the shift from cell survival to apoptosis.
25579883 Tauroursodeoxycholic acid activates PERK, an eIF2alpha kinase of the endoplasmic reticulum in HepG2 cells.
25475719 autophagy receptor genes SQSTM1/p62, NBR1 and BNIP3L/NIX are transcriptionally upregulated in response to ER stress and inhibition of the UPR transmembrane receptors, PERK and IRE1, abrogates this upregulation
25393282 TBL2 interacts with PERK via the N-terminus proximal region and also associates with eIF2a via the WD40 domain thus modulating stress-signaling and cell survival during endoplasmic reticulum stress.
25226532 findings suggest that the abnormal unfolded protein responses, especially IRE1/XBP1 and PERK/CHOP axes, may contribute to SLE pathogenesis, which may be potential diagnosis indicators or treatment targets.
25203443 Neoplastic de-differentiation confers multidrug resistance via non-canonical PERK-Nrf2 signaling.
25183803 ER stress-PERK-GSK3alpha/beta signaling promotes proatherogenic macrophage lipid accumulation
25131821 Data from 2 consanguineous families suggest EIF2AK3 mutations (c.1337_1338insT/p.K346*; c.3009C>T/p.R903*) account for Wolcott-Rallison syndrome; ultrastructural features of autopsy materials suggest endoplasmic reticulum dysfunction. [CASE STUDIES]
24874742 selenite activated PERK and eIF2alpha/ATF4 downstream to promote apoptosis.
24846185 To enable a detailed study of PERK signaling we have generated an analog-sensitive PERK allele that accepts N(6)-alkylated ATP analogs.
24813399 The study demonstrates that subsequently excessive NO generation in RPE cells can have an unanticipated effect by activating PERK pathways in ECs, resulting in a novel mechanism for vascular endothelium to avoid injury from prolonged hyperglycemia.
24705811 Epithelial-to-mesenchymal transition activates PERK-eIF2alpha and sensitizes cells to endoplasmic reticulum stress
24664756 These studies indicate that activation of either IRE1, ATF6, or PERK prevents mutant rhodopsin from accumulating in the cells.
24594363 In erythroid cells, pull down experiments identified the presence of a novel complex formed by HDAC5, GATA1, EKLF and pERK which was instead undetectable in cells of the megakaryocytic lineage.
24252572 Study demonstrated a genetic association between an EIF2AK3 protein coding haplotype and progressive supranuclear palsy (PSP), indicating that variation in the PERK protein affects PSP risk
24168455 genetic association study in population of children in South India: Data suggest that mutations in EIF2AK3 are associated with permanent neonatal diabetes mellitus in Wolcott-Rallison syndrome; study includes 8 children from 5 unrelated families.
24114838 interplay between calcineurin and PERK regulates beta-cell Ca(2+) signaling and insulin secretion, and that loss of this interaction may have profound implications in insulin secretion defects associated with diabetes.
24103755 down-regulation of PERK resulted in increased clonogenic survival, enhanced DNA repair and reduced apoptosis in irradiated cancer cells.
24097291 Studied different expressions of PERK between the spinal ligament fibroblasts from OPLL patients and non-OPLL patients, and demonstrate knockdown of PERK by RNA interference inhibiting expression of OCN, ALP, and COL I in the cells from OPLL patients.
23830192 The PERK signaling arm is uniquely important for promoting adaptation and survival during hypoxia-induced ER stress and should be the focus of future therapeutic efforts.
23759358 However, the available data indicate that KSA has the largest collection of patients with WRS worldwide, and nine of the identifiable EIF2AK3 mutations appear to be confined to Arabs
23592989 the induction of PERK during human cytomegalovirus infection is necessary for full activation of lipogenesis; this effect appears to be mediated by limiting the levels of Insig1 thus freeing SREBP1-SCAP complexes for SREBP1 processing
23585173 Direct sequencing of the EIF2AK3 gene identified a homozygous frameshift mutation (c.1259delA) in all patients that has been reported only in these families.
23471998 PERK/eIF2alpha signaling protects therapy resistant hypoxic cells through induction of glutathione synthesis and protection against ROS.
23294542 the PERK/ATF4/LAMP3-arm of the UPR is an additional pathway mediating hypoxia-induced breast cancer cell migration
23160380 increased autophagy, secondary to persistent PERK and LKB1-AMPK signaling, can robustly protect cells from anoikis and promote luminal filling during early carcinoma progression
23116876 Genotypes at MOBP and EIF2AK3 confer risk predominantly in APOE epsilon4-positive subjects, with indications of an interaction between APOE and MOBP or EIF2AK3 on Alzheimer's disease risk.
23110043 ER stress activates NF-kappaB by integrating functions of basal IKK activity, IRE1 and PERK.
23103912 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1alpha-mediated unfolded protein response.
22956602 This study indicates that selectively activating ATF6 or PERK prevents mutant rhodopsin from accumulating in retinal cells.
22917505 one of three endoplasmic reticulum transmembrane protein sensors that signals the unfolded protein response [review]
22915762 results show that the PERK/ATF4 arm of UPR mediates the angiogenic switch and is a potential target for antiangiogenic cancer therapy.
22813743 PERK plays a critical role in information processing and cognitive function and that modulation of eIF2alpha phosphorylation and ATF4 expression.
22446326 BiP binds to IRE1 and PERK in a different manner.
22354021 ubtilase cytotoxin -induced ER stress is caused by BiP cleavage, leading to PERK activation, not by accumulation of ubiquitinated proteins, which undergo PERK-dependent degradation via the ubiquitin-proteasome system.
22253692 Transcriptional profiling by cDNA microarray combined with reverse genetics revealed phosphorylation of the eukaryotic initiation factor 2-alpha (EIF2A) through the eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3/PERK).
22246806 Saturated fatty acid-induced ER stress and apoptosis in these human liver cells were enacted through the PERK/ATF4/CHOP signaling pathway.
22169477 H(2)S in inhibiting PTP1B activity and thereby promoting PERK activity during the response to ER stress
22072062 Endoplasmic reticulum stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22028037 Common nonsynonymous sequence variants in EIF2AK3 have a modest effect on endoplasmic reticulum stress response.
21709020 Data show that luminal P-PERK and LC3 levels are reduced in PERK-deficient mammary glands, whereas they are increased in human breast ductal carcinoma in situ.
21648287 ETF2AK3 gene mutations can lead to the onset of Wolcott-Rallison syndrome.
21518408 We observed in case 1 a homozygous C > T replacement at base pair c.1192 at exon 7, generating a stop codon at position 398; in case 2, a duplication of base pair c.851A at exon 5 (c.851dupA) leading to a frameshift and a stop codon at position 285
21464971 Exposure of human umbilical vein endothelial cells to HIV-1 Tat causes broad activation of the unfolded-protein response in ER with phosphorylation of PERK, eIF2alpha, and JNK and induction of Grp78/BiP
21419175 Results identify ERp29 as a novel regulator of PERK and provide evidence for the role of ER resident factors in the regulation of chemotherapeutic efficacy.
21385877 early DENV-2 infection triggers and then suppresses PERK-mediated eIF2alpha phosphorylation and that in mid and late DENV-2 infection, the IRE1-XBP1 and ATF6 pathways are activated, respectively
20800603 Observational study of gene-disease association. (HuGE Navigator)
20709135 The PERK signaling pathway plays a major role in the action of fluoride on osteoblasts; the bone response in skeletal fluorosis may be due in part to the PERK signaling pathway.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20463975 These results indicate that PERK-eIF2alpha pathway is a potential target for therapeutic applications in neurodegenerative diseases including Alzheimer's disease.
20457808 Exposure of human umbilical vein endothelial cells to HIV-1 Tat causes broad activation of the unfolded-protein response in ER with phosphorylation of PERK, eIF2alpha, and JNK and induction of Grp78/BiP
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20348950 PERK is essential for radiation-induced autophagy and radiosensitivity in caspase-3/7 double-knockout cells.
20202148 this report describe clinical features of six patients with Wolcott-Rallison syndrome from two families carrying the same homozygous mutation (W522X) in the EIF2AK3 gene.
20103619 Findings indicate that mda-7/IL-24 induces PERK activation that triggers production of ceramide, ceramide synthase 6 and thioredoxin, which in turn promote glioma cell autophagy and cell death.
20072656 Findings indicate that GRP78 is a biologic target of vorinostat, and activation of the UPR through PERK phosphorylation contributes toward its antitumor activity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837917 EIF2AK3 should be tested in patients with isolated neonatal diabetes diagnosed after 3 weeks of age from known consanguineous families, isolated populations, or countries in which inbreeding is frequent.
19586904 UV-induced eIF2alpha phosphorylation by activation of both PERK and GCN2 via oxidative stress and l-arginine starvation signaling pathways.
19029953 PERK activity inhibits the ER stress-induced apoptotic program through the induction of cellular inhibitor of apoptosis (cIAP1 and cIAP2) proteins
19009018 Exposure of human umbilical vein endothelial cells to HIV-1 Tat causes broad activation of the unfolded-protein response in ER with phosphorylation of PERK, eIF2alpha, and JNK and induction of Grp78/BiP
18787411 Vorinostat and sorafenib increase ER stress, autophagy and apoptosis via ceramide-dependent CD95 and PERK activation
18664456 PC2, but not pathogenic mutants E837X and R872X, represses cell proliferation through promoting the phosphorylation of eukaryotic translation initiation factor eIF2alpha by pancreatic ER-resident eIF2alpha kinase (PERK).
18451152 The growth-inhibitory function of PERK is preserved in tumors and upon proper reactivation can severely inhibit tumor growth through induction of quiescence.
18426796 analysis of endoplasmic reticulum (ER) chaperone regulation and survival of cells compensating for deficiency in the ER stress response kinase, PERK
18216498 PERK signaling acts to suppress autophagy and lysosomal dysfunction by increasing the expression of HSP70.
18063576 PKR and PKR-like endoplasmic reticulum kinase induce the proteasome-dependent degradation of cyclin D1 via a mechanism requiring eukaryotic initiation factor 2alpha phosphorylation
17823375 carbon monoxide renders endothelial cells resistant to stress by upregulating Nrf2-dependent HO-1 expression via PERK activation
17785458 PERK activates glycogen synthase kinase 3 to promote the proteasomal degradation of p53.
17229688 is the first description of a virus-encoded PERK-specific effector and defines a new strategy by which viruses are able to maintain endoplasmic reticulum homeostasis
16148948 Inactivation of integrated-stress-response signaling by mutations in the ER kinase PERK and the translation initiation factor eIF2alpha or by a dominant-negative PERK impairs cell survival under extreme hypoxia.
15650164 activated by Herpes simplex virus 1 infection
15483661 This pilot study demonstrates an association between the EIF2AK3 gene region and susceptibility to type I diabetes.
15220213 Genetic heterogeneity between this variant form of WRS and EIF2AK3 WRS correlates with some clinical heterogeneity.
12610133 results show that PERK binds to and is also inhibited by the hepatitis C virus envelope protein E2
12370288 PERK plays a role in hypoxia-induced translational attenuation
12086964 Loss of kinase activity in a patient with Wolcott-Rallison syndrome caused by a novel mutation
12014989 Distinct roles in transcription during the mammalian unfolded protein response.

AA Sequence

MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVPAAGAVAAAEV      1 - 70
TVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDPENHGKKQWDLDVGSGSLVSS     71 - 140
SLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLSAYSG    141 - 210
KVRYICSALGCRQWDSDEMEQEEDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIE    211 - 280
STFKPNENTEESKIISDVEEQEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKV    281 - 350
IPISLFDDTSYTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE    351 - 420
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYYLPYYKRERN    421 - 490
KRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVRRLFHPHPHRQRKESETQCQ    491 - 560
TENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRE    561 - 630
LAREKVMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRM    631 - 700
DPFATKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCD    701 - 770
VEDGTMDGNDEGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF    771 - 840
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERE    841 - 910
RSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYAR    911 - 980
HTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCE    981 - 1050
YVMVQDMLSPSPMERPEAINIIENAVFEDLDFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN       1051 - 1116
//

Text Mined References (120)

PMID Year Title
27238082 2016 Compounds Triggering ER Stress Exert Anti-Melanoma Effects and Overcome BRAF Inhibitor Resistance.
26642955 2016 CREB is activated by ER stress and modulates the unfolded protein response by regulating the expression of IRE1? and PERK.
26634309 2015 The Malat1 long non-coding RNA is upregulated by signalling through the PERK axis of unfolded protein response during flavivirus infection.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26446798 2015 Regulation of the unfolded protein response via S-nitrosylation of sensors of endoplasmic reticulum stress.
26279443 2015 Lipopolysaccharide Induces Autophagic Cell Death through the PERK-Dependent Branch of the Unfolded Protein Response in Human Alveolar Epithelial A549 Cells.
26268696 2015 TMEM33: a new stress-inducible endoplasmic reticulum transmembrane protein and modulator of the unfolded protein response signaling.
26259235 2015 PERK/CHOP contributes to the CGK733-induced vesicular calcium sequestration which is accompanied by non-apoptotic cell death.
26225772 2015 Protein kinase R-like ER kinase and its role in endoplasmic reticulum stress-decided cell fate.
26078722 2015 PERK-mediated Autophagy in Osteosarcoma Cells Resists ER Stress-induced Cell Apoptosis.
25976933 2015 HIV infection and antiretroviral therapy lead to unfolded protein response activation.
25925385 2015 Crystal structures reveal transient PERK luminal domain tetramerization in endoplasmic reticulum stress signaling.
25761777 2015 PERK silence inhibits glioma cell growth under low glucose stress by blockage of p-AKT and subsequent HK2's mitochondria translocation.
25692299 2015 Noncanonical binding of BiP ATPase domain to Ire1 and Perk is dissociated by unfolded protein CH1 to initiate ER stress signaling.
25675914 2015 Expression of markers of endoplasmic reticulum stress-induced apoptosis in the placenta of women with early and late onset severe pre-eclampsia.
25633195 2015 Imaging of single cell responses to ER stress indicates that the relative dynamics of IRE1/XBP1 and PERK/ATF4 signalling rather than a switch between signalling branches determine cell survival.
25579883 2015 Tauroursodeoxycholic acid prevents stress induced aggregation of proteins in vitro and promotes PERK activation in HepG2 cells.
25475719 2015 A close connection between the PERK and IRE arms of the UPR and the transcriptional regulation of autophagy.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25393282 2014 TBL2 is a novel PERK-binding protein that modulates stress-signaling and cell survival during endoplasmic reticulum stress.
25329545 2015 p58IPK is an inhibitor of the eIF2? kinase GCN2 and its localization and expression underpin protein synthesis and ER processing capacity.
25226532 2014 Deficiency of IRE1 and PERK signal pathways in systemic lupus erythematosus.
25203443 2014 De-differentiation confers multidrug resistance via noncanonical PERK-Nrf2 signaling.
25183803 2014 Protein kinase R-like endoplasmic reticulum kinase and glycogen synthase kinase-3?/? regulate foam cell formation.
25131821 2015 Microscopic and ultrastructural features in Wolcott-Rallison syndrome, a permanent neonatal diabetes mellitus: about two autopsy cases.
24874742 2014 Involvement of p38 in signal switching from autophagy to apoptosis via the PERK/eIF2?/ATF4 axis in selenite-treated NB4 cells.
24846185 2014 Generation and characterization of an analog-sensitive PERK allele.
24813399 2014 PERK pathway are involved in NO-induced apoptosis in endothelial cells cocultured with RPE under high glucose conditions.
24705811 2014 Epithelial-to-mesenchymal transition activates PERK-eIF2? and sensitizes cells to endoplasmic reticulum stress.
24664756 2014 The effects of IRE1, ATF6, and PERK signaling on adRP-linked rhodopsins.
24594363 2014 Identification of NuRSERY, a new functional HDAC complex composed by HDAC5, GATA1, EKLF and pERK present in human erythroid cells.
24252572 2013 The unfolded protein response is activated in disease-affected brain regions in progressive supranuclear palsy and Alzheimer's disease.
24168455 2014 EIF2AK3 mutations in South Indian children with permanent neonatal diabetes mellitus associated with Wolcott-Rallison syndrome.
24114838 2013 Insulin secretion and Ca2+ dynamics in ?-cells are regulated by PERK (EIF2AK3) in concert with calcineurin.
24103755 2013 Down-regulation of PERK enhances resistance to ionizing radiation.
24097291 2014 Upregulated expression of PERK in spinal ligament fibroblasts from the patients with ossification of the posterior longitudinal ligament.
23830192 2013 New small molecule inhibitors of UPR activation demonstrate that PERK, but not IRE1? signaling is essential for promoting adaptation and survival to hypoxia.
23759358 2013 Frequency and spectrum of Wolcott-Rallison syndrome in Saudi Arabia: a systematic review.
23592989 2013 PKR-like endoplasmic reticulum kinase is necessary for lipogenic activation during HCMV infection.
23585173 2013 Variable phenotype in five patients with Wolcott-Rallison syndrome due to the same EIF2AK3 (c.1259delA) mutation.
23471998 2013 PERK/eIF2? signaling protects therapy resistant hypoxic cells through induction of glutathione synthesis and protection against ROS.
23294542 2013 Hypoxia stimulates migration of breast cancer cells via the PERK/ATF4/LAMP3-arm of the unfolded protein response.
23160380 2013 Regulation of autophagy during ECM detachment is linked to a selective inhibition of mTORC1 by PERK.
23116876 2013 An exploratory study on STX6, MOBP, MAPT, and EIF2AK3 and late-onset Alzheimer's disease.
23110043 2012 ER stress activates NF-?B by integrating functions of basal IKK activity, IRE1 and PERK.
23103912 2012 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1?-mediated unfolded protein response.
23000344 2013 Ursolic acid induces ER stress response to activate ASK1-JNK signaling and induce apoptosis in human bladder cancer T24 cells.
22956602 2012 Selective activation of ATF6 and PERK endoplasmic reticulum stress signaling pathways prevent mutant rhodopsin accumulation.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
22917505 2012 Unfolded protein response.
22915762 2012 The unfolded protein response induces the angiogenic switch in human tumor cells through the PERK/ATF4 pathway.
22813743 2012 Brain-specific disruption of the eIF2? kinase PERK decreases ATF4 expression and impairs behavioral flexibility.
22446326 2012 Binding of human BiP to the ER stress transducers IRE1 and PERK requires ATP.
22354021 2012 Regulation of subtilase cytotoxin-induced cell death by an RNA-dependent protein kinase-like endoplasmic reticulum kinase-dependent proteasome pathway in HeLa cells.
22253692 2012 Mechanism-based screen for G1/S checkpoint activators identifies a selective activator of EIF2AK3/PERK signalling.
22246806 2012 Saturated fatty acid induction of endoplasmic reticulum stress and apoptosis in human liver cells via the PERK/ATF4/CHOP signaling pathway.
22169477 2011 H2S-Induced sulfhydration of the phosphatase PTP1B and its role in the endoplasmic reticulum stress response.
22072062 2012 ER stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22028037 2012 A functional haplotype in EIF2AK3, an ER stress sensor, is associated with lower bone mineral density.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21709020 2011 PERK integrates autophagy and oxidative stress responses to promote survival during extracellular matrix detachment.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
21648287 2011 A novel EIF2AK3 mutation leading to Wolcott-Rallison syndrome in a Chinese child.
21518408 2011 Two novel mutations in the EIF2AK3 gene in children with Wolcott-Rallison syndrome.
21419175 2011 ERp29 regulates response to doxorubicin by a PERK-mediated mechanism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385877 2011 Dengue virus modulates the unfolded protein response in a time-dependent manner.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20709135 2010 Activation of PERK signaling through fluoride-mediated endoplasmic reticulum stress in OS732 cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20463975 2010 Activation of PERK signaling attenuates Abeta-mediated ER stress.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20348950 2010 Endoplasmic reticulum stress mediates radiation-induced autophagy by perk-eIF2alpha in caspase-3/7-deficient cells.
20202148 2010 Wolcott-Rallison syndrome due to the same mutation (W522X) in EIF2AK3 in two unrelated families and review of the literature.
20103619 2010 PERK-dependent regulation of ceramide synthase 6 and thioredoxin play a key role in mda-7/IL-24-induced killing of primary human glioblastoma multiforme cells.
20072656 2010 Activation of the unfolded protein response contributes toward the antitumor activity of vorinostat.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837917 2009 Wolcott-Rallison syndrome is the most common genetic cause of permanent neonatal diabetes in consanguineous families.
19816510 2010 Essential role of the unfolded protein response regulator GRP78/BiP in protection from neuronal apoptosis.
19586904 2009 The role of nitric-oxide synthase in the regulation of UVB light-induced phosphorylation of the alpha subunit of eukaryotic initiation factor 2.
19061639 2008 Role of SERCA1 truncated isoform in the proapoptotic calcium transfer from ER to mitochondria during ER stress.
19029953 2009 PERK-dependent regulation of IAP translation during ER stress.
18787411 2008 Vorinostat and sorafenib increase ER stress, autophagy and apoptosis via ceramide-dependent CD95 and PERK activation.
18664456 2008 Polycystin-2 down-regulates cell proliferation via promoting PERK-dependent phosphorylation of eIF2alpha.
18451152 2008 Dual function of pancreatic endoplasmic reticulum kinase in tumor cell growth arrest and survival.
18426796 2008 Endoplasmic reticulum (ER) chaperone regulation and survival of cells compensating for deficiency in the ER stress response kinase, PERK.
18216498 2008 PERK-dependent regulation of HSP70 expression and the regulation of autophagy.
18063576 2008 PKR and PKR-like endoplasmic reticulum kinase induce the proteasome-dependent degradation of cyclin D1 via a mechanism requiring eukaryotic initiation factor 2alpha phosphorylation.
17823375 2007 Carbon monoxide induces heme oxygenase-1 via activation of protein kinase R-like endoplasmic reticulum kinase and inhibits endothelial cell apoptosis triggered by endoplasmic reticulum stress.
17785458 2007 The eIF2alpha kinases PERK and PKR activate glycogen synthase kinase 3 to promote the proteasomal degradation of p53.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17229688 2007 Maintenance of endoplasmic reticulum (ER) homeostasis in herpes simplex virus type 1-infected cells through the association of a viral glycoprotein with PERK, a cellular ER stress sensor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16148948 2005 ER stress-regulated translation increases tolerance to extreme hypoxia and promotes tumor growth.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15650164 2005 Herpes simplex virus 1 infection activates the endoplasmic reticulum resident kinase PERK and mediates eIF-2alpha dephosphorylation by the gamma(1)34.5 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483661 2004 The EIF2AK3 gene region and type I diabetes in subjects from South India.
15220213 2004 Wolcott-Rallison Syndrome: clinical, genetic, and functional study of EIF2AK3 mutations and suggestion of genetic heterogeneity.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517290 2003 Nrf2 is a direct PERK substrate and effector of PERK-dependent cell survival.
12610133 2003 Protein synthesis and endoplasmic reticulum stress can be modulated by the hepatitis C virus envelope protein E2 through the eukaryotic initiation factor 2alpha kinase PERK.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446838 2002 Control of PERK eIF2alpha kinase activity by the endoplasmic reticulum stress-induced molecular chaperone P58IPK.
12446770 2002 Heat shock protein 90 modulates the unfolded protein response by stabilizing IRE1alpha.
12370288 2002 Regulation of protein synthesis by hypoxia via activation of the endoplasmic reticulum kinase PERK and phosphorylation of the translation initiation factor eIF2alpha.
12014989 2002 Distinct roles of activating transcription factor 6 (ATF6) and double-stranded RNA-activated protein kinase-like endoplasmic reticulum kinase (PERK) in transcription during the mammalian unfolded protein response.
11907036 2002 Dimerization and release of molecular chaperone inhibition facilitate activation of eukaryotic initiation factor-2 kinase in response to endoplasmic reticulum stress.
11555640 2001 Translation inhibition in apoptosis: caspase-dependent PKR activation and eIF2-alpha phosphorylation.
10932183 2000 EIF2AK3, encoding translation initiation factor 2-alpha kinase 3, is mutated in patients with Wolcott-Rallison syndrome.
10677345 2000 Pancreatic eukaryotic initiation factor-2alpha kinase (PEK) homologues in humans, Drosophila melanogaster and Caenorhabditis elegans that mediate translational control in response to endoplasmic reticulum stress.
10575235 1999 Assignment of pancreatic eIF-2alpha kinase (EIF2AK3) to human chromosome band 2p12 by radiation hybrid mapping and in situ hybridization.
10026192 1999 Characterization of a mutant pancreatic eIF-2alpha kinase, PEK, and co-localization with somatostatin in islet delta cells.
9819435 1998 Identification and characterization of pancreatic eukaryotic initiation factor 2 alpha-subunit kinase, PEK, involved in translational control.
8099443 1993 Mammalian eukaryotic initiation factor 2 alpha kinases functionally substitute for GCN2 protein kinase in the GCN4 translational control mechanism of yeast.
1677563 1991 A synthetic peptide substrate for initiation factor-2 kinases.