Property Summary

Ligand Count 3
NCBI Gene PubMed Count 303
PubMed Score 89.95
PubTator Score 700.03

Knowledge Summary

Patent (65,091)

Expression

  Differential Expression (19)

Synonym

Accession P19525 A8K3P0 D6W584 E9PC80 Q52M43 Q7Z6F6 Q9UIR4
Symbols PKR
PRKR
EIF2AK1
PPP1R83

Gene

Gene RIF (234)

AA Sequence

MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKL      1 - 70
AVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQK     71 - 140
EYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSA    141 - 210
DTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQ    211 - 280
VFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPEN    281 - 350
SKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI    351 - 420
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFE    421 - 490
TSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC             491 - 551
//

Text Mined References (327)

PMID Year Title