Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.88
PubTator Score 13.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (3)

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVW      1 - 70
INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDED     71 - 140
IDDI                                                                      141 - 144
//

Text Mined References (20)

PMID Year Title