Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.44
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 689 0.0 0.0
Disease Target Count P-value
osteosarcoma 7766 2.1e-08
atypical teratoid / rhabdoid tumor 4971 4.0e-07
ovarian cancer 8297 4.6e-03
group 3 medulloblastoma 4002 5.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.0e-07
group 3 medulloblastoma 1.200 5.4e-03
osteosarcoma -2.312 2.1e-08
ovarian cancer 1.300 4.6e-03

Gene RIF (1)

AA Sequence

MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLI      1 - 70
VDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDD     71 - 140
SDLFVNTNRRQYHESEEESEEEEAA                                                 141 - 165
//

Text Mined References (18)

PMID Year Title