Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.09
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 6.1e-03
cystic fibrosis 1.115 5.6e-04
medulloblastoma, large-cell -1.500 1.3e-04
oligodendroglioma -1.400 1.2e-02
osteosarcoma -1.199 5.7e-03
ovarian cancer -1.100 2.9e-04
pancreatic cancer -1.100 3.0e-03
pancreatic carcinoma -1.100 3.0e-03

Gene RIF (1)

AA Sequence

MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEAL      1 - 70
EEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLS     71 - 140
DCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDL    141 - 210
SSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRL    211 - 280
PILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY                     281 - 333
//

Text Mined References (9)

PMID Year Title