Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.42
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer -1.100 3.0e-03
astrocytic glioma -1.500 6.1e-03
oligodendroglioma -1.400 1.2e-02
osteosarcoma -1.199 5.7e-03
cystic fibrosis 1.115 5.6e-04
medulloblastoma, large-cell -1.500 1.3e-04
pancreatic carcinoma -1.100 3.0e-03
ovarian cancer -1.100 2.9e-04

Gene RIF (1)

PMID Text
15987788 EID3 acts as an inhibitor of CBP/p300-dependent transcription in a tissue-specific manner.

AA Sequence

MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEAL      1 - 70
EEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLS     71 - 140
DCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDL    141 - 210
SSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRL    211 - 280
PILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY                     281 - 333
//

Text Mined References (9)

PMID Year Title
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15987788 2005 EID3 is a novel EID family member and an inhibitor of CBP-dependent co-activation.
15752197 2005 Qri2/Nse4, a component of the essential Smc5/6 DNA repair complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.