Property Summary

NCBI Gene PubMed Count 5
PubMed Score 20.29
PubTator Score 20.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
oligodendroglioma 2849 2.8e-02
astrocytic glioma 2241 3.0e-02
Disease Target Count Z-score Confidence
Salpingitis 6 3.472 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.200 3.0e-02
oligodendroglioma -1.300 2.8e-02

Gene RIF (1)

PMID Text
14612439 EID-2 may function as an endogenous suppressor of TGF-beta signaling

AA Sequence

MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAAREGRMAAARAAP      1 - 70
AAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEGPEGRPRSRHGNGGLAALPYL     71 - 140
RLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDAEYQRNPHRVDLDILTF    141 - 210
TIALTASEVINPLIEELGCDKFINRE                                                211 - 236
//

Text Mined References (9)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15970276 2005 A novel EID family member, EID-3, inhibits differentiation and forms a homodimer or heterodimer with EID-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612439 2004 A novel E1A-like inhibitor of differentiation (EID) family member, EID-2, suppresses transforming growth factor (TGF)-beta signaling by blocking TGF-beta-induced formation of Smad3-Smad4 complexes.
14585496 2003 EID-2, a novel member of the EID family of p300-binding proteins inhibits transactivation by MyoD.
12586827 2003 A novel EID-1 family member, EID-2, associates with histone deacetylases and inhibits muscle differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.