Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.82
PubTator Score 12.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
osteosarcoma 7933 5.0e-04
lung cancer 4473 2.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.324 5.0e-04
lung cancer 1.500 2.0e-02

Gene RIF (7)

PMID Text
26342551 Low EI24 and high IGF-1R expressions in lung cancer patients.
24821838 Ei24 can bind specifically to IMPbeta1 and IMPalpha2 to impede their normal role in nuclear import.
24280371 Findings establish EI24 as a critical suppressor of tumor progression.
24014029 Ei24 is a novel E2F1 target gene contributing to the survival of p53-deficient cells upon UVC irradiation and thus may have a potential significance as a therapeutic target of certain chemotherapy for treating p53-deficient tumors.
21803008 LOH11CR2A, PIG8 and CHEK1 are candidate tumor suppressor genes associated with breast carcinoma and have significant clinical as well as prognostic importance.
21154811 our data suggest that inactivation of EI24 and CHEK1 through two independent mechanisms contributes to the development of CACX.
17981155 identify the EI24/PIG8 status as a potentially new prognostic marker of chemotherapy responsiveness

AA Sequence

MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSR      1 - 70
IFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKV     71 - 140
VNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSL    141 - 210
LYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEA    211 - 280
KTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH              281 - 340
//

Text Mined References (31)

PMID Year Title
26342551 2015 Reduced expression of EI24 confers resistance to gefitinib through IGF-1R signaling in PC9 NSCLC cells.
24821838 2014 The p53-induced factor Ei24 inhibits nuclear import through an importin ?-binding-like domain.
24280371 2013 EI24 regulates epithelial-to-mesenchymal transition and tumor progression by suppressing TRAF2-mediated NF-?B activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24014029 2013 Ei24, a novel E2F target gene, affects p53-independent cell death upon ultraviolet C irradiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21803008 2011 Frequent alterations of LOH11CR2A, PIG8 and CHEK1 genes at chromosomal 11q24.1-24.2 region in breast carcinoma: clinical and prognostic implications.
21269460 2011 Initial characterization of the human central proteome.
21154811 2011 Inactivation of CHEK1 and EI24 is associated with the development of invasive cervical carcinoma: clinical and prognostic implications.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17981155 2007 Loss of putative tumor suppressor EI24/PIG8 confers resistance to etoposide.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11753653 2001 Candidate tumour suppressor genes at 11q23-q24 in breast cancer: evidence of alterations in PIG8, a gene involved in p53-induced apoptosis.
11498783 2001 Tissue specific expression of p53 target genes suggests a key role for KILLER/DR5 in p53-dependent apoptosis in vivo.
10965130 2000 The p53-inducible gene EI24/PIG8 localizes to human chromosome 11q23 and the proximal region of mouse chromosome 9.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10594026 2000 ei24, a p53 response gene involved in growth suppression and apoptosis.
9305847 1997 A model for p53-induced apoptosis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.