Property Summary

Ligand Count 11
NCBI Gene PubMed Count 58
PubMed Score 219.79
PubTator Score 64.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 6.9e-05
ependymoma 2.200 2.7e-03
group 3 medulloblastoma 1.200 1.2e-02
juvenile dermatomyositis 1.468 4.2e-13
medulloblastoma, large-cell 1.100 1.2e-03
oligodendroglioma 1.700 2.9e-03
osteosarcoma 1.119 2.2e-03
ovarian cancer 1.900 1.7e-05
primary pancreatic ductal adenocarcinoma 1.473 6.3e-04
primitive neuroectodermal tumor 1.400 4.7e-05
Rheumatoid arthritis 1.600 1.1e-02

 OMIM Phenotype (1)

Protein-protein Interaction (1)

PDB (16)

Gene RIF (35)

AA Sequence

MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAA      1 - 70
KHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTT     71 - 140
STLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKS    141 - 210
VVGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFV    211 - 280
LAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDE    281 - 350
DDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSES    351 - 420
SIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLDLR    421 - 490
VKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKY    491 - 560
ELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHC    561 - 630
GEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTG    631 - 700
PAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEH    701 - 770
QNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGS    771 - 840
TCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICL    841 - 910
HWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCAS    911 - 980
LNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPM    981 - 1050
NIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVV   1051 - 1120
QNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDAR   1121 - 1190
FYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGS   1191 - 1260
PKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL                                   1261 - 1298
//

Text Mined References (73)

PMID Year Title