Property Summary

NCBI Gene PubMed Count 42
PubMed Score 222.25
PubTator Score 38.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis 3.200 1.9e-10
posterior fossa group B ependymoma 4.100 3.4e-11
Atopic dermatitis 1.900 2.6e-05
pancreatic ductal adenocarcinoma liver m... 2.962 2.2e-02
tuberculosis -1.700 6.7e-05
non-small cell lung cancer 1.689 2.1e-13
intraductal papillary-mucinous adenoma (... 2.900 3.0e-04
intraductal papillary-mucinous carcinoma... 3.100 2.9e-04
intraductal papillary-mucinous neoplasm ... 2.900 3.3e-03
lung cancer -6.500 1.4e-06
pancreatic cancer 1.100 4.0e-04
interstitial cystitis -3.800 2.3e-05
invasive ductal carcinoma -2.046 4.6e-02
lung adenocarcinoma 1.186 2.6e-03
Endometriosis -1.188 1.5e-02
lung carcinoma 1.200 1.5e-07
spina bifida -2.797 3.0e-02
Breast cancer -1.600 1.5e-03
ovarian cancer 4.600 1.2e-08

Gene RIF (16)

PMID Text
25950810 This study suggests that ESE3 plays an important role in the carcinogenesis of Esophageal Squamous Cell Carcinoma through changes in subcellular localization and may act as a tumor suppressor gene in Esophageal Squamous Cell Carcinoma.
24219556 Results suggest PPAR-gamma to be involved in the regulation of ESE-3b expression during monocyte-derived dendritic cells (moDCs) development and that ESE-3 expression is not correlated with the immunogenicity of dendritic cells (DCs).
24105369 EHF modifies the CF phenotype by altering capabilities of the epithelial cell to correctly process the folding and trafficking of mutant p.Phe508del-CFTR.
23439650 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23185370 ESE-3b is the functionally most important ESE-3 isoform in dendritic cells
22505649 Low ESE3/EHF expression was also associated with increased biochemical recurrence of prostate cancer and reduced overall survival after prostatectomy
21855111 EHF mRNA levels differentiate ovarian carcinoma from malignant mesothelioma. EHF may be a novel prognostic marker in ovarian carcinoma.
21617703 These results indicate that EHF-mediated RUVBL1 expression allows colon tumour cells to avoid p53-mediated apoptosis.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18475289 ESE-1 and ESE-3 play an important role in airway inflammation.
18037958 Implicated as a candidate tumor suppressor in prostate cancer; decreased expression may result in loss of important regulatory mechanisms in prostate epithelial cells.
17627613 ESE-3 plays a role in the induction of cellular senescence as a downstream molecule of stress-induced mitogen-activated protein kinase p38.
17172423 Aberrant expression of EHF and the subsequent disruption of p27-mediated senescence and telomerase activity is likely to contribute significantly to tumor progression. EHF might be a promising target for future cancer therapeutics.
17027647 In addition, we show the possible involvement of co-factors CBP and p300 in ESE-3-mediated DR-5 up-regulation.
12444029 Overexpression of ESE-3 protein in human bronchial smooth muscle cells inhibits MMP-1 promoter activity, suggesting that ESE-3 may function as a transcriptional repressor.
12359648 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDA      1 - 70
NCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIM     71 - 140
NTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLW    141 - 210
EFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVD    211 - 280
GRRLVYKFGKNARGWRENEN                                                      281 - 300
//

Text Mined References (43)

PMID Year Title
25950810 2015 Abnormal Localization and Tumor Suppressor Function of Epithelial Tissue-Specific Transcription Factor ESE3 in Esophageal Squamous Cell Carcinoma.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24219556 2014 Activation of peroxisome proliferator-activated receptor gamma leads to upregulation of ESE-3 expression in human monocyte-derived dendritic cells.
24105369 2014 The CF-modifying gene EHF promotes p.Phe508del-CFTR residual function by altering protein glycosylation and trafficking in epithelial cells.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23439650 2013 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23185370 2012 Expression of ESE-3 isoforms in immunogenic and tolerogenic human monocyte-derived dendritic cells.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22505649 2012 ESE3/EHF controls epithelial cell differentiation and its loss leads to prostate tumors with mesenchymal and stem-like features.
21855111 2012 Expression of the Ets transcription factor EHF in serous ovarian carcinoma effusions is a marker of poor survival.
21617703 2011 A member of the ETS family, EHF, and the ATPase RUVBL1 inhibit p53-mediated apoptosis.
21602797 2011 Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2.
21491078 2011 Differential expression of ETS family members in prostate cancer tissues and androgen-sensitive and insensitive prostate cancer cell lines.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18475289 2008 Regulation of epithelium-specific Ets-like factors ESE-1 and ESE-3 in airway epithelial cells: potential roles in airway inflammation.
18044710 2008 ESE-1 is a potent repressor of type II collagen gene (COL2A1) transcription in human chondrocytes.
18037958 2008 Reduced expression and tumor suppressor function of the ETS transcription factor ESE-3 in prostate cancer.
17905856 2007 Transactivation of lung lysozyme expression by Ets family member ESE-1.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17627613 2007 ESE-3, an Ets family transcription factor, is up-regulated in cellular senescence.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17172821 2007 Profile of Ets gene expression in human breast carcinoma.
17172423 2006 Influence of small interfering RNA corresponding to ets homologous factor on senescence-associated modulation of prostate carcinogenesis.
17027647 2006 ESE-3 transcription factor is involved in the expression of death receptor (DR)-5 through putative Ets sites.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16380452 2006 Epithelial-specific transcription factor ESE-3 is involved in the development of monocyte-derived DCs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12713734 2003 The epithelial-specific ETS transcription factor ESX/ESE-1/Elf-3 modulates breast cancer-associated gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444029 2002 Constitutive and cytokine-induced expression of the ETS transcription factor ESE-3 in the lung.
12407165 2002 Expression of the ETS transcription factor ELF3 in the retinal pigment epithelium.
12359648 2002 DNA sequence variants in epithelium-specific ETS-2 and ETS-3 are not associated with asthma.
11259407 2001 The epithelium-specific ETS protein EHF/ESE-3 is a context-dependent transcriptional repressor downstream of MAPK signaling cascades.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10644770 2000 ESE-3, a novel member of an epithelium-specific ets transcription factor subfamily, demonstrates different target gene specificity from ESE-1.
10527851 1999 Human chromosomal localization, tissue/tumor expression, and regulatory function of the ets family gene EHF.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.