Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.04
PubTator Score 211.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.300 1.4e-02
hepatocellular carcinoma -1.400 7.7e-05
Multiple myeloma 1.196 2.2e-02
glioblastoma 1.700 1.8e-03
osteosarcoma -2.120 8.4e-04
juvenile dermatomyositis 1.471 4.1e-11
tuberculosis -1.100 3.1e-04
intraductal papillary-mucinous adenoma (... -1.100 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.7e-03
group 4 medulloblastoma -1.300 1.1e-03
pilocytic astrocytoma 2.200 2.1e-07
primary Sjogren syndrome 1.100 3.8e-03
subependymal giant cell astrocytoma 2.836 2.4e-03
mucosa-associated lymphoid tissue lympho... 1.083 4.1e-02
ovarian cancer 3.200 8.3e-07

Gene RIF (6)

PMID Text
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
23325686 Ezrin and EHD4 appear to be involved in the ability of Nef to increase hiv-1 virus infectivity.
23325686 Knockdown of EHD4 by siRNA induces decreased levels of nef-deleted HIV-1 infectivity and decreases the ability of HIV-1 Nef to increase virus infectivity
21187387 Retrograde signaling through Pincher-generated Trk-multivesicular bodies is distinctively refractory to signal termination by lysosomal processing
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.
18331452 EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

AA Sequence

MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQY      1 - 70
STGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFM     71 - 140
CSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAF    141 - 210
RGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQD    211 - 280
LFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQ    281 - 350
ISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT    351 - 420
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKL    421 - 490
ADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD                       491 - 541
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019528 2013 Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23325686 2013 Comparative proteomic analysis of HIV-1 particles reveals a role for Ezrin and EHD4 in the Nef-dependent increase of virus infectivity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21187387 2011 Trk retrograde signaling requires persistent, Pincher-directed endosomes.
20489164 2010 EH domain proteins regulate cardiac membrane protein targeting.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18331452 2008 A role for EHD4 in the regulation of early endosomal transport.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17233914 2007 Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
11533061 2001 Characterization of EHD4, an EH domain-containing protein expressed in the extracellular matrix.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10673336 2000 EHD2, EHD3, and EHD4 encode novel members of a highly conserved family of EH domain-containing proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.