Property Summary

NCBI Gene PubMed Count 29
PubMed Score 52.23
PubTator Score 93.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.127 4.9e-02
malignant mesothelioma -3.200 1.3e-07
astrocytic glioma -1.700 5.7e-04
ependymoma -2.000 1.4e-02
esophageal adenocarcinoma -2.400 1.8e-02
glioblastoma -2.100 2.2e-05
oligodendroglioma -1.400 3.6e-12
medulloblastoma -2.800 2.5e-09
atypical teratoid / rhabdoid tumor -2.400 1.7e-09
medulloblastoma, large-cell -3.000 8.4e-06
primitive neuroectodermal tumor -1.700 1.1e-03
adrenocortical carcinoma -1.566 7.5e-05
pancreatic ductal adenocarcinoma liver m... -1.725 7.7e-04
pediatric high grade glioma -1.900 1.1e-07
spina bifida -1.513 3.2e-02
Pick disease -1.100 2.5e-02
ulcerative colitis 1.200 1.3e-03
ovarian cancer 1.300 2.2e-03

Protein-protein Interaction (3)

Gene RIF (12)

PMID Text
27189942 the residues Ala-519/Asp-520 of EHD1 and Asn-519/Glu-520 of EHD3 as defining the selectivity of these two paralogs for NPF-containing binding partners
24997812 The EHD3 gene may be associated with the endophenotype of cognitive function in major depressive disorder patients.
24607927 3 SNPs present in the EHD3 gene, of which rs619002 and rs644926 were exclusively associated with female major depressive disorder
24306026 demonstrate Ehd3 growth inhibitory functions in glioma cells in vivo. We suggest that Ehd3 functions as a tumor suppressor gene and loss of its expression is a very common event in gliomas
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
22406195 EHD3 is a previously unrecognized component of the cardiac remodeling pathway in heart failure.
22337703 The combined effect of the EHD3 and FREM3 genes may play an important role in developing major depressive disorder.
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.
19139087 Our findings support a role for EHD3 in regulating endosome-to-Golgi transport, and as a consequence, lysosomal biosynthetic, but not secretory, transport pathways are also affected
17507647 Rab8a and Myosin Vb colocalize to a tubular network containing EHD1 and EHD3, which does not contain Rab11a.
16251358 presented herein promote a coordinated role for EHD proteins and Rab11-FIP2 in mediating endocytic recycling and provide evidence for the function of EHD3 in early endosome to endocytic recycling compartment transport
12121420 EHD3: a protein that resides in recycling tubular and vesicular membrane structures and interacts with EHD1.

AA Sequence

MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQ     71 - 140
LPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFR    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISP    281 - 350
GDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHG    351 - 420
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADI    421 - 490
DKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE                             491 - 535
//

Text Mined References (36)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
26226295 2015 SUMOylation of EHD3 Modulates Tubulation of the Endocytic Recycling Compartment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686250 2015 Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
24997812 2014 Association between EHD3 gene and the cognitive function of patients with major depressive disorder.
24607927 2014 The gender-specific association of EHD3 polymorphisms with major depressive disorder.
24306026 2014 Ehd3, a regulator of vesicular trafficking, is silenced in gliomas and functions as a tumor suppressor by controlling cell cycle arrest and apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
24019528 2013 Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.
23781025 2013 ?v?3-integrin-mediated adhesion is regulated through an AAK1L- and EHD3-dependent rapid-recycling pathway.
23754701 2014 Chemical shift assignments of the C-terminal Eps15 homology domain-3 EH domain.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
22406195 2012 Differential regulation of EHD3 in human and mammalian heart failure.
22337703 2012 A study of the combined effects of the EHD3 and FREM3 genes in patients with major depressive disorder.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21791287 2011 Endocytosis promotes rapid dopaminergic signaling.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20489164 2010 EH domain proteins regulate cardiac membrane protein targeting.
19864458 2009 MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19139087 2009 EHD3 regulates early-endosome-to-Golgi transport and preserves Golgi morphology.
18331452 2008 A role for EHD4 in the regulation of early endosomal transport.
17507647 2007 Myosin Vb interacts with Rab8a on a tubular network containing EHD1 and EHD3.
17233914 2007 Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16251358 2006 Interactions between EHD proteins and Rab11-FIP2: a role for EHD3 in early endosomal transport.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15020713 2004 Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121420 2002 EHD3: a protein that resides in recycling tubular and vesicular membrane structures and interacts with EHD1.
11423532 2001 Association of insulin-like growth factor 1 receptor with EHD1 and SNAP29.
10673336 2000 EHD2, EHD3, and EHD4 encode novel members of a highly conserved family of EH domain-containing proteins.