Property Summary

NCBI Gene PubMed Count 26
PubMed Score 27.77
PubTator Score 497.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -2.900 9.2e-06
osteosarcoma 1.469 2.9e-04
glioblastoma 1.200 3.0e-04
lung cancer -2.200 1.1e-04
colon cancer -1.600 2.1e-03
breast carcinoma -1.300 2.0e-03
fibroadenoma -1.600 1.7e-02
pediatric high grade glioma 1.100 1.2e-04
group 3 medulloblastoma -1.200 1.5e-03
Polycystic Ovary Syndrome -1.470 7.1e-03
lung carcinoma -1.100 3.0e-14
ductal carcinoma in situ -1.900 1.5e-03
invasive ductal carcinoma -2.700 9.4e-04
ovarian cancer 1.400 1.3e-05

Gene RIF (11)

PMID Text
25875965 Data suggest that the EH-domain containing 2 protein (EHD2) NPF phenylalanine residue is crucial for EHD2 localization to the plasma membrane, whereas the proline residue is essential for EHD2 dimerization and binding.
25758127 EHD2 can inhibit the metastasis of human breast cancer by regulating the epithelial-to-mesenchymal transition markers E-cadherin and N-cadherin.
25557791 Downregulation of EHD2 was associated with migration and invasion by abrogating the expression of Rac1 in breast cancer patients.
24040268 Phosphatidylinositol 4,5-bisphosphate controls EHD2 plasma membrane localization.
23354948 Our results suggested that EHD2 low expression is involved in the pathogenesis of human esophageal squamous cell carcinoma
22679923 EHD2 participates in the sarcolemma repair.
22505029 Confining caveolae to the plasma membrane by EHD2 relied on its capacity to link caveolae to actin filaments.
22448906 Among three EHD proteins (EHD1-EHD3) that were tested, only EHD2 accumulates in the nucleus under nuclear export inhibition treatment.
22323287 Assembly of EHD2 stabilized and constrained caveolae to the plasma membrane to control turnover, and depletion of EHD2, resulting in endocytic and more dynamic and short-lived caveolae.
21756249 EHD2 regulates trafficking from the plasma membrane by controlling Rac1 activity.
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.

AA Sequence

MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPMVLVAGQYSTG      1 - 70
KTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDKPFRKLNPFGNTFLNRFMCAQ     71 - 140
LPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGH    141 - 210
EDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFR    211 - 280
DIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISP    281 - 350
GDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG    351 - 420
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIW    421 - 490
KLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE                     491 - 543
//

Text Mined References (34)

PMID Year Title
25875965 2015 Role of the EHD2 unstructured loop in dimerization, protein binding and subcellular localization.
25758127 2015 Decreased expression and prognostic role of EHD2 in human breast carcinoma: correlation with E-cadherin.
25557791 2015 Role of EHD2 in migration and invasion of human breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040268 2013 Role of phosphatidylinositol 4,5-bisphosphate in regulating EHD2 plasma membrane localization.
24013648 2013 Molecular composition and ultrastructure of the caveolar coat complex.
23354948 2013 Effects of EHD2 interference on migration of esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679923 2012 Sarcolemmal repair is a slow process and includes EHD2.
22505029 2012 Oligomers of the ATPase EHD2 confine caveolae to the plasma membrane through association with actin.
22448906 2012 EHD2 shuttles to the nucleus and represses transcription.
22323287 2012 EHD2 regulates caveolar dynamics via ATP-driven targeting and oligomerization.
21756249 2011 EHD2 mediates trafficking from the plasma membrane by modulating Rac1 activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20489164 2010 EH domain proteins regulate cardiac membrane protein targeting.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18502764 2008 The endocytic recycling protein EHD2 interacts with myoferlin to regulate myoblast fusion.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17914359 2007 Architectural and mechanistic insights into an EHD ATPase involved in membrane remodelling.
17233914 2007 Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16155252 2005 C-terminal EH-domain-containing proteins: consensus for a role in endocytic trafficking, EH?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15182197 2004 EHD2 interacts with the insulin-responsive glucose transporter (GLUT4) in rat adipocytes and may participate in insulin-induced GLUT4 recruitment.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15020713 2004 Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676205 2004 EHD2 and the novel EH domain binding protein EHBP1 couple endocytosis to the actin cytoskeleton.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673336 2000 EHD2, EHD3, and EHD4 encode novel members of a highly conserved family of EH domain-containing proteins.