Property Summary

NCBI Gene PubMed Count 55
PubMed Score 478.03
PubTator Score 89.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.097 3.2e-02
Astrocytoma, Pilocytic 1.100 8.4e-04
ependymoma 1.300 1.3e-06
gastric carcinoma 1.200 4.3e-02
glioblastoma 1.800 3.3e-05
lung cancer -1.400 2.3e-02
lung carcinoma -1.200 2.2e-20
medulloblastoma, large-cell 1.100 2.6e-03
osteosarcoma -1.131 9.1e-04
ovarian cancer -1.300 1.9e-07
pancreatic cancer 1.100 3.3e-04
pancreatic ductal adenocarcinoma liver m... 1.197 4.2e-03
pediatric high grade glioma 1.500 4.1e-05
Polycystic ovary syndrome -1.027 6.3e-03
psoriasis 1.700 7.9e-04
tuberculosis -1.300 3.5e-08
ulcerative colitis 1.200 4.5e-05

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQ     71 - 140
LPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFK    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISP    281 - 350
GDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG    351 - 420
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADV    421 - 490
DKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE                              491 - 534
//

Text Mined References (69)

PMID Year Title