Property Summary

NCBI Gene PubMed Count 27
PubMed Score 8.22
PubTator Score 4.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 1.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.011 7.2e-03
breast carcinoma -1.100 3.9e-16
chronic rhinosinusitis -1.066 9.3e-03
dermatomyositis 1.300 2.5e-04
Duchenne muscular dystrophy 1.038 4.3e-06
ductal carcinoma in situ -1.500 4.7e-04
glioblastoma -1.200 6.3e-03
group 4 medulloblastoma -1.300 3.3e-03
invasive ductal carcinoma -1.800 3.0e-04
juvenile dermatomyositis 1.026 5.5e-11
medulloblastoma, large-cell -1.500 3.4e-03
ovarian cancer -1.100 6.2e-03
Pick disease 1.500 2.0e-05
psoriasis -1.500 4.0e-12
tuberculosis 1.300 9.4e-07

Gene RIF (14)

AA Sequence

MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVV      1 - 70
VWPVPENIEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKP     71 - 140
LSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKI    141 - 210
TEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNP    211 - 280
FGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDM    281 - 350
SKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVS    351 - 420
AGKDLSTSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLI    421 - 490
DYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEEN    491 - 560
SSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREPELQQPISGAVDFLSQDDSVFVNDSGVGESESEHQT    561 - 630
PDDHLSPSTASPYCRRTKSDTEPQKSQQSSGRTSGSDDPGICSNTDSTQAQVLLGKKRLLKAETLELSDL    631 - 700
YVSDKKKDMSPPFICEETDEQKLQTLDIGSNLEKEKLENSRSLECRSDPESPIKKTSLSPTSKLGYSYSR    701 - 770
DLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRLLSRQEELKERARVLLEQARRDAALKAGNKH    771 - 840
NTNTATPFCNRQLSDQQDEERRRQLRERARQLIAEARSGVKMSELPSYGEMAAEKLKERSKASGDENDNI    841 - 910
EIDTNEEIPEGFVVGGGDELTNLENDLDTPEQNSKLVDLKLKKLLEVQPQVANSPSSAAQKAVTESSEQD    911 - 980
MKSGTEDLRTERLQKTTERFRNPVVFSKDSTVRKTQLQSFSQYIENRPEMKRQRSIQEDTKKGNEEKAAI    981 - 1050
TETQRKPSEDEVLNKGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWF   1051 - 1120
MLVNKKNALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVNKRD   1121 - 1190
ALVRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCVLQ                                1191 - 1231
//

Text Mined References (41)

PMID Year Title