Property Summary

NCBI Gene PubMed Count 38
PubMed Score 311.83
PubTator Score 68.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
ependymoma -2.300 3.9e-02
oligodendroglioma -2.100 1.5e-08
astrocytoma -1.700 2.7e-08
glioblastoma -1.900 3.1e-02
medulloblastoma -3.300 2.5e-04
atypical teratoid / rhabdoid tumor -2.800 3.1e-03
medulloblastoma, large-cell -3.600 7.8e-03
primitive neuroectodermal tumor -3.300 5.1e-03
Atopic dermatitis -1.500 1.2e-03
adrenocortical adenoma -1.280 4.0e-02
adrenocortical carcinoma -3.049 1.0e-06
tuberculosis and treatment for 6 months -1.100 2.7e-02
primary pancreatic ductal adenocarcinoma 1.006 2.4e-02
non-small cell lung cancer -1.874 4.7e-11
lung cancer -4.200 2.5e-06
Breast cancer -3.700 4.6e-12
interstitial cystitis 2.100 1.6e-03
cystic fibrosis 2.500 4.4e-04
non primary Sjogren syndrome sicca -2.500 5.2e-03
breast carcinoma -2.200 2.8e-23
gastric carcinoma 2.600 2.0e-02
ulcerative colitis 3.300 1.9e-07
chronic rhinosinusitis -1.901 4.9e-02

Gene RIF (35)

PMID Text
26474411 These findings support previously reported associations between EGR3 and schizophrenia.
25633035 EGR3 promotes excessive production of IL6 and IL8 observed during the progression of prostate cancer.
25613138 The gene expression of early growth response 3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24886494 Data shows association of Egr3 genetic polymorphisms and coronary artery disease in the Uygur and Han of China
23962955 Genetic variation in EGR3 may affect prefrontal function through neurodevelopment
23935197 These data suggest that type I IFN stimulation induces a rapid recruitment of a repressive Egr3/Nab1 complex that silences transcription from the ifngr1 promoter.
23906810 These results provide the first evidence that Egr-3, is up-regulated in scleroderma and is necessary and sufficient for profibrotic responses.
23904169 Our results suggest that Egr-3 is a transcription factor associated with TGF-beta1 expression and in vivo regulatory activity
23485457 EGR2 and EGR3 are regulated by NFkappaB and MAPK signalling pathways downstream of TNFalpha stimulation in breast adipose fibroblasts, and this in turn is upstream of CYP19A1 transcription via PI.4
23460371 Decreased EGR3 expression might play a critical role in the differentiation, proliferation, metastasis and progression of gastric cancer cells.
23342084 Egr3 mRNA expression reveals that Egr3 mRNA expression is increased in tumor cells of non-relapsed samples compared to normal prostate cells, but is significantly lower in relapsed samples compared to non-relapse.
22425949 EGR3 gene may play an important role in schizophrenia susceptibility
22370066 EGR3, a gene that translates environmental stimuli into long-term changes in the brain, may be associated with risk for child bipolar disorder 1.
22276163 Study supports the association of EGR3 with schizophrenia in Han Chinese sample.
21421043 EGR3 bound to the TREM-1 promoter.
20687139 SNP rs35201266 in intron 1 of the EGR3 gene showed a significant association with schizophrenia
20687139 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20537399 This study demoistrated that ERG3 are not genetic risk factors for schizophrenia in japanese.
20537399 Observational study of gene-disease association. (HuGE Navigator)
20506119 Results suggest that in many cells of neuroectodermal and epithelial origin EGR1, EGR2, and EGR3 activate NAB2 transcription which is in turn repressed by NAB2, thus establishing a negative feedback loop.
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20144677 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19965691 Egr-3 is a critical determinant of VEGF signaling in activated endothelial cells
19839995 Observational study of gene-disease association. (HuGE Navigator)
19822898 Data show that VEGFR1 promoter binding sites for ELF-1, CREB and EGR-1/3 play a positive role in gene transcription in endothelial cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19124717 Enforced expression of Egr3 transgene, from the CD2 antigen promoter, facilitates development of RAG2-deficient double-negative (DN) stage 3 thymocytes to the DN4 stage and subsequently to the double-positive stage of development.
18059339 findings indicate that Egr3 has an essential downstream role in VEGF-mediated endothelial functions leading to angiogenesis and may have particular relevance for adult angiogenic processes involved in vascular repair and neovascular disease
17360599 These findings support the previous genetic association of altered calcineurin signaling with schizophrenia pathogenesis and identify EGR3 as a compelling susceptibility gene.
15173177 Egr-2 and Egr-3 transcription is enhanced by Hepatitis B virus X protein, which induces fasL gene expression
15171706 data suggest that Egr3 is a target for the estrogen receptor alpha
14525795 Vascularendothelial growth factor induces expression of NR4A nuclear receptors and Egr3 via KDR and KDR-mediated signaling mechanisms.
11909874 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter
11909874 The gene expression of early growth response 3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells

AA Sequence

MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSY      1 - 70
SGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAM     71 - 140
YPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHK    141 - 210
PFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAE    211 - 280
GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKR    281 - 350
HAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA                                     351 - 387
//

Text Mined References (40)

PMID Year Title
26474411 2015 Association of SNPs in EGR3 and ARC with Schizophrenia Supports a Biological Pathway for Schizophrenia Risk.
25633035 2015 Early Growth Response 3 regulates genes of inflammation and directly activates IL6 and IL8 expression in prostate cancer.
24886494 2014 Association of Egr3 genetic polymorphisms and coronary artery disease in the Uygur and Han of China.
23962955 2014 Association of decreased prefrontal hemodynamic response during a verbal fluency task with EGR3 gene polymorphism in patients with schizophrenia and in healthy individuals.
23935197 2013 Type I IFNs downregulate myeloid cell IFN-? receptor by inducing recruitment of an early growth response 3/NGFI-A binding protein 1 complex that silences ifngr1 transcription.
23906810 2013 Early growth response 3 (Egr-3) is induced by transforming growth factor-? and regulates fibrogenic responses.
23904169 2013 Transcription factor early growth response 3 is associated with the TGF-?1 expression and the regulatory activity of CD4-positive T cells in vivo.
23485457 2013 NF?B and MAPK signalling pathways mediate TNF?-induced Early Growth Response gene transcription leading to aromatase expression.
23460371 2013 Decreased EGR3 expression is related to poor prognosis in patients with gastric cancer.
23342084 2013 Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer.
22425949 2012 [A family-based association study of the EGR3 gene polymorphisms and schizophrenia].
22370066 2012 Family-based association study of early growth response gene 3 with child bipolar I disorder.
22276163 2012 Genetic evidence for the association between the early growth response 3 (EGR3) gene and schizophrenia.
21421043 2011 TREM-1 and DAP12 expression in monocytes of patients with severe psychiatric disorders. EGR3, ATF3 and PU.1 as important transcription factors.
20687139 2010 EGR3 as a potential susceptibility gene for schizophrenia in Korea.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20537399 2011 Association of calcineurin A gamma subunit (PPP3CC) and early growth response 3 (EGR3) gene polymorphisms with susceptibility to schizophrenia in a Japanese population.
20506119 2010 EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20144677 2010 No association between EGR gene family polymorphisms and schizophrenia in the Chinese population.
19965691 2010 Vascular endothelial growth factor activation of endothelial cells is mediated by early growth response-3.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19822898 2009 Differential roles for ETS, CREB, and EGR binding sites in mediating VEGF receptor 1 expression in vivo.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19124717 2009 Pre-TCR-induced beta-catenin facilitates traversal through beta-selection.
18059339 2008 The zinc-finger transcription factor, early growth response 3, mediates VEGF-induced angiogenesis.
17360599 2007 Genetic analysis of the calcineurin pathway identifies members of the EGR gene family, specifically EGR3, as potential susceptibility candidates in schizophrenia.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15173177 2004 Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor.
15171706 2004 Transcription factor EGR3 is involved in the estrogen-signaling pathway in breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525795 2003 Vascular endothelial growth factor-regulated gene expression in endothelial cells: KDR-mediated induction of Egr3 and the related nuclear receptors Nur77, Nurr1, and Nor1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11909874 2002 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter.
9731539 1998 Sensory ataxia and muscle spindle agenesis in mice lacking the transcription factor Egr3.
9488654 1998 A screen for genes induced in the suprachiasmatic nucleus by light.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8443122 1993 Expression of PILOT, a putative transcription factor, requires two signals and is cyclosporin A sensitive in T cells.
1906159 1991 EGR3, a novel member of the Egr family of genes encoding immediate-early transcription factors.