Property Summary

NCBI Gene PubMed Count 83
PubMed Score 317.50
PubTator Score 166.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -3.500 5.4e-09
lung carcinoma -1.700 1.8e-08

 GO Component (2)

 GWAS Trait (2)

Gene RIF (58)

PMID Text
26718337 These results suggested that EGR2 overexpression has a pivotal role in the downregulation of cytokines implicated in the pathophysiology of Guillain-Barre syndrome
26238942 MicroRNA20a promotes the proliferation and cell cycle of human osteosarcoma cells by suppressing EGR2 expression.
26214589 EGR2 knockdown inhibited proliferation, clonogenicity and spheroidal growth in vitro and induced regression of Ewing sarcoma xenografts.
26204789 EGR2 mutation presents as an axonal Charcot-Marie-Tooth phenotype with variable severity.
26119399 A recurrent mutation was identified in EGR2 which appears to be associated with the pathogenesis of schizophrenia.
25935837 Knock-down of EGR2 with siRNA was demonstrated to have a similar effect as the over-expression of miR-330-3p in NSCLC cell lines
25613138 The gene expression of early growth response 2 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25548232 our data suggest that robust CD26 costimulatory signaling induces preferential expression of EGR2 and IL-10 as a potential mechanism for regulating CD26-mediated activation.
25381473 Dysregulated Egr-2 is observed in some human autoimmune disorders.
24007274 transcription factor early growth response gene-2 is a novel molecular switch regulating known immunomodulatory molecules in human mesenchymal stem cells.
23924943 Overexpression of EGR2 significantly attenuated the oncogenic effect of miR-20a.
23747400 Lack of association of EGR2 variants with bipolar disorder in Japanese population.
23485457 EGR2 and EGR3 are regulated by NFkappaB and MAPK signalling pathways downstream of TNFalpha stimulation in breast adipose fibroblasts, and this in turn is upstream of CYP19A1 transcription via PI.4
22915601 Egr2 expression is translationally regulated via an IRES element, which is responsive to an inflammatory environment.
22765307 In the title.
22734907 we report on a heterozygous mutation in EGR2 in a family with a mild demyelinating form of adult-onset Charcot-Marie-Tooth disease
22691714 data suggest a tendency of gender-specific association of EGR2 and EGR4 in schizophrenia.
22546699 Charcot-Marie-Tooth neuropathy due to a novel EGR2 gene mutation exhibits a mild phenotype in a Czech family.
22522483 data further demonstrate the major role of the myelinating Schwann cell element in the regulation of EGR2 expression in the human peripheral nervous system
22327514 Common variants near TARDBP and EGR2 are associated with susceptibility to Ewing sarcoma.
22271166 Results identify a mutation in EGR2 in a Charcot-Marie-tooth disease patient with hypersensitivity to vincristine.
22089088 Combined with a plausible biological function of EGR2, the EGR2 gene is a possible susceptibility gene in bipolar disorder.
21836637 Krox20 functions as a SUMO ligase for its coregulators--the Nab proteins--and that Nab sumoylation negatively modulates Krox20 transcriptional activity in vivo.
21703609 TGF-beta3 regulated Egr-2 gene expression in uterine leiomyoma cells.
21514423 these findings suggest that Egr-2 plays an important nonredundant role in the pathogenesis of fibrosis.
21479245 These data define serum response factor as a host cell transcription factor that regulates immediate early gene expression in Toxoplasma-infected cells.
21057508 Schwann cells expressed myelin proteins and Krox20 which is an important regulator of peripheral myelination.
21042708 EGR2 is a direct transcriptional target of p53 family that can in part mediate the p53-dependent apoptotic pathway.
20687139 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20513111 EGR2 mutation(amino aacid substitution) identifies a case of Charcot-Marie-Totth disease.
20506119 Results suggest that in many cells of neuroectodermal and epithelial origin EGR1, EGR2, and EGR3 activate NAB2 transcription which is in turn repressed by NAB2, thus establishing a negative feedback loop.
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20194224 EGR2 is a genetic risk factor for Systemic lupus erythematosus (SLE), in which increased gene expression may contribute to SLE pathogenesis.
20194224 Observational study of gene-disease association. (HuGE Navigator)
20144677 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20067763 overexpression of miR-150 in gastric cancer could promote proliferation and growth of cancer cells at least partially through directly targeting the tumor-suppressor EGR2.
19651900 AIP2 regulates activation-induced T-cell death by suppressing EGR2-mediated FasL expression via the ubiquitin pathway
19453261 Observational study of gene-disease association. (HuGE Navigator)
19000991 Dysregulation of EGR2 and MeCP2 plays roles in in Rett syndrome and autism.
18678671 Collectively, these data indicate that EGR2 is specifically upregulated by a parasite-derived secreted factor that is most likely a resident rhoptry protein.
17717711 morphological studies in the context of the I268N homozygous recessive mutation affecting the NAB repressor binding site and the R359W dominant-negative mutation in the zinc-finger domain
16912585 Observational study of genotype prevalence. (HuGE Navigator)
16495311 Control of Krox20 transcription relies on three very long-range enhancer elements (A, B and C) that are conserved in chick, mouse and human genomes.
16198564 Observational study of genotype prevalence. (HuGE Navigator)
16198564 One novel de-novo mutation (Arg359Gln, R359Q) was identified in heterozygous state in a patient with a typical CMT1 phenotype, progressive moderate thoracolumbar scoliosis and without clinical signs of cranial nerve dysfunction.
15947997 A Charcot-Marie-Tooth syndrome in a family with a missense mutation in EGR2.
15173177 Egr-2 and Egr-3 transcription is enhanced by Hepatitis B virus X protein, which induces fasL gene expression
14596916 a possible molecular mechanism to account for down-regulation of EGR2 in tumor cells
12736090 This report detected a heterozygous Asp383Tyr mutation of EGR2 in one patient with severe CMT1, Dejerine-Sottas syndrome.
12687019 we found that EGR2 could induce apoptosis in a large proportion of these lines by altering the permeability of mitochondrial membranes, releasing cytochrome c and activating caspase-3, -8, and -9.
12609493 EGR2 mutant D355V induces a Cx32 promoter, mutant R381H doesn't. A sequence located at -216, recognized by the wild-type and the mutant D355V recombinant proteins, is relevant for promoter transactivation.
12471219 Observational study of gene-disease association. (HuGE Navigator)
12471219 Frequency of mutations in the early growth response 2 gene associated with peripheral demyelinating neuropathies
11909874 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter
11909874 The gene expression of early growth response 2 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11835375 Observational study of genotype prevalence. (HuGE Navigator)
11545686 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRS      1 - 70
LDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSAS     71 - 140
PNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPS    141 - 210
PKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGV    211 - 280
TGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR    281 - 350
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH    351 - 420
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP                  421 - 476
//

Text Mined References (82)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26718337 2016 Expression of Early Growth Response Gene-2 and Regulated Cytokines Correlates with Recovery from Guillain-Barré Syndrome.
26238942 2015 MicroRNA?20a promotes the proliferation and cell cycle of human osteosarcoma cells by suppressing early growth response 2 expression.
26214589 2015 Chimeric EWSR1-FLI1 regulates the Ewing sarcoma susceptibility gene EGR2 via a GGAA microsatellite.
26204789 2015 The EGR2 gene is involved in axonal Charcot-Marie-Tooth disease.
26119399 2015 Resequencing of early growth response 2 (EGR2) gene revealed a recurrent patient-specific mutation in schizophrenia.
25935837 2015 miR-330-3p controls cell proliferation by targeting early growth response 2 in non-small-cell lung cancer.
25548232 2015 CD26-mediated induction of EGR2 and IL-10 as potential regulatory mechanism for CD26 costimulatory pathway.
25381473 2015 The roles of Egr-2 in autoimmune diseases.
25108386 2014 Genome-wide association analysis of Vogt-Koyanagi-Harada syndrome identifies two new susceptibility loci at 1p31.2 and 10q21.3.
24007274 2014 Early growth response-2 signaling mediates immunomodulatory effects of human multipotential stromal cells.
23924943 2013 Involvement of miR-20a in promoting gastric cancer progression by targeting early growth response 2 (EGR2).
23747400 2013 Lack of association of EGR2 variants with bipolar disorder in Japanese population.
23485457 2013 NF?B and MAPK signalling pathways mediate TNF?-induced Early Growth Response gene transcription leading to aromatase expression.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22915601 2012 IRES-dependent translation of egr2 is induced under inflammatory conditions.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22765307 2013 Mutational analysis of PMP22, EGR2, LITAF and NEFL in Greek Charcot-Marie-Tooth type 1 patients.
22734907 2012 A novel EGR2 mutation within a family with a mild demyelinating form of Charcot-Marie-Tooth disease.
22691714 2012 Genetic and functional analyses of early growth response (EGR) family genes in schizophrenia.
22546699 2012 Charcot-Marie-Tooth neuropathy due to a novel EGR2 gene mutation with mild phenotype--usefulness of human mapping chip linkage analysis in a Czech family.
22522483 2012 Homozygous deletion of an EGR2 enhancer in congenital amyelinating neuropathy.
22327514 2012 Common variants near TARDBP and EGR2 are associated with susceptibility to Ewing sarcoma.
22271166 2012 Vincristine exacerbates asymptomatic Charcot-Marie-tooth disease with a novel EGR2 mutation.
22089088 2012 Genetic association of the EGR2 gene with bipolar disorder in Korea.
21836637 2011 The transcription factor Krox20 is an E3 ligase that sumoylates its Nab coregulators.
21703609 2011 Early growth response-2 expression in uterine leiomyoma cells: regulation and function.
21514423 2011 The early growth response gene Egr2 (Alias Krox20) is a novel transcriptional target of transforming growth factor-? that is up-regulated in systemic sclerosis and mediates profibrotic responses.
21479245 2011 Serum response factor regulates immediate early host gene expression in Toxoplasma gondii-infected host cells.
21057508 2010 Yy1 as a molecular link between neuregulin and transcriptional modulation of peripheral myelination.
21042708 2010 Identification and characterization of early growth response 2, a zinc-finger transcription factor, as a p53-regulated proapoptotic gene.
20687139 2010 EGR3 as a potential susceptibility gene for schizophrenia in Korea.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20513111 2010 Adult onset Charcot-Marie-Tooth disease type 1D with an Arg381Cys mutation of EGR2.
20506119 2010 EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20194224 2010 Regulatory polymorphisms in EGR2 are associated with susceptibility to systemic lupus erythematosus.
20144677 2010 No association between EGR gene family polymorphisms and schizophrenia in the Chinese population.
20067763 2010 MiR-150 promotes gastric cancer proliferation by negatively regulating the pro-apoptotic gene EGR2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19651900 2009 The HECT-type E3 ubiquitin ligase AIP2 inhibits activation-induced T-cell death by catalyzing EGR2 ubiquitination.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19000991 2009 Reciprocal co-regulation of EGR2 and MECP2 is disrupted in Rett syndrome and autism.
18678671 2008 Toxoplasma gondii rhoptry discharge correlates with activation of the early growth response 2 host cell transcription factor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17717711 2007 Functional, histopathologic and natural history study of neuropathy associated with EGR2 mutations.
16912585 2006 Mutation frequency for Charcot-Marie-Tooth disease type 1 in the Chinese population is similar to that in the global ethnic patients.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
16495311 2006 Krox20 hindbrain cis-regulatory landscape: interplay between multiple long-range initiation and autoregulatory elements.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16198564 2005 Novel EGR2 mutation R359Q is associated with CMT type 1 and progressive scoliosis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15947997 2005 Two missense mutations of EGR2 R359W and GJB1 V136A in a Charcot-Marie-Tooth disease family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15241803 2004 Mutational analysis of PMP22, MPZ, GJB1, EGR2 and NEFL in Korean Charcot-Marie-Tooth neuropathy patients.
15173177 2004 Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14596916 2003 Methylation at CpG islands in intron 1 of EGR2 confers enhancer-like activity.
14532282 2003 HCF-1 functions as a coactivator for the zinc finger protein Krox20.
12736090 2003 Screening of the early growth response 2 gene in Japanese patients with Charcot-Marie-Tooth disease type 1.
12687019 2003 EGR2 induces apoptosis in various cancer cell lines by direct transactivation of BNIP3L and BAK.
12609493 2003 Different consequences of EGR2 mutants on the transactivation of human Cx32 promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471219 2002 Frequency of mutations in the early growth response 2 gene associated with peripheral demyelinating neuropathies.
11909874 2002 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter.
11835375 2002 Charcot-Marie-Tooth disease and related neuropathies: mutation distribution and genotype-phenotype correlation.
11545686 Screening for mutations in a genetically heterogeneous disorder: DHPLC versus DNA sequence for mutation detection in multiple genes causing Charcot-Marie-Tooth neuropathy.
11523566 2001 EGR2 mutation R359W causes a spectrum of Dejerine-Sottas neuropathy.
11239949 2001 A novel missense mutation in the early growth response 2 gene associated with late-onset Charcot--Marie--Tooth disease type 1.
10960786 2000 Pattern of expression of the transcription factor Krox-20 in mouse hair follicle.
10762521 2000 Cranial nerve involvement in CMT disease type 1 due to early growth response 2 gene mutation.
10502832 1999 A novel mutation (D305V) in the early growth response 2 gene is associated with severe Charcot-Marie-Tooth type 1 disease.
10371530 1999 Novel missense mutation in the early growth response 2 gene associated with Dejerine-Sottas syndrome phenotype.
10369870 1999 Functional consequences of mutations in the early growth response 2 gene (EGR2) correlate with severity of human myelinopathies.
9537424 1998 Mutations in the early growth response 2 (EGR2) gene are associated with hereditary myelinopathies.
8702157 1996 Role of Krox-20 in endochondral bone formation.
8093858 1993 The zinc finger gene Krox20 regulates HoxB2 (Hox2.8) during hindbrain segmentation.
7935840 1994 Krox-20 controls myelination in the peripheral nervous system.
3140236 1988 Molecular cloning, sequencing, and mapping of EGR2, a human early growth response gene encoding a protein with "zinc-binding finger" structure.
2496302 1989 Structure, chromosome location, and expression of the mouse zinc finger gene Krox-20: multiple gene products and coregulation with the proto-oncogene c-fos.
2111009 1990 The serum and TPA responsive promoter and intron-exon structure of EGR2, a human early growth response gene encoding a zinc finger protein.