Property Summary

NCBI Gene PubMed Count 359
PubMed Score 1948.53
PubTator Score 1031.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2346 5.088 2.5
Vascular disease 281 4.406 2.2

Expression

  Differential Expression (32)

Disease log2 FC p
Rheumatoid Arthritis 1.800 4.2e-03
nephrosclerosis -2.762 2.4e-05
oligodendroglioma -1.700 1.3e-02
psoriasis -2.200 8.5e-10
astrocytoma 2.900 6.3e-03
glioblastoma 2.200 6.0e-04
medulloblastoma, large-cell -2.200 2.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.822 3.9e-02
adrenocortical carcinoma -2.317 1.2e-03
primary pancreatic ductal adenocarcinoma 1.538 4.5e-02
non-small cell lung cancer -2.141 1.0e-13
intraductal papillary-mucinous adenoma (... -1.800 2.1e-04
intraductal papillary-mucinous carcinoma... -1.100 2.3e-02
intraductal papillary-mucinous neoplasm ... -1.300 5.0e-02
lung cancer -2.900 2.0e-05
colon cancer -2.000 3.3e-02
inflammatory breast cancer -4.300 2.3e-08
interstitial cystitis 1.500 2.3e-03
group 4 medulloblastoma -2.100 9.0e-03
non primary Sjogren syndrome sicca -1.600 1.6e-02
lung adenocarcinoma -1.402 6.6e-04
lung carcinoma -2.600 9.0e-12
breast carcinoma -2.100 6.6e-23
gastric carcinoma 2.500 5.5e-03
pterygium -2.100 3.9e-02
invasive ductal carcinoma -1.800 4.9e-03
acute myeloid leukemia 2.000 3.3e-02
ulcerative colitis 2.200 2.9e-04
ovarian cancer 2.300 1.8e-04
pituitary cancer -2.700 2.0e-04
Down syndrome -1.400 3.5e-03
pancreatic cancer 1.400 3.4e-02

Protein-protein Interaction (4)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
588618 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in DLD1 cells
588644 other 0 / 0 / 3 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in HCT116 human colorectal carcinoma cells
588657 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in HT29 human colorectal carcinoma cells
588665 other 1 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in SW620 human colorectal carcinoma cells

Gene RIF (331)

PMID Text
27002148 in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop.
26975996 In nucleus pulposus cells early transcriptional programming initiated by EGR1 is essentially restrained by the cells' epigenome as it was determined during development and differentiation.
26792551 Functional changes of EGR1 (and miR-132) during the course of Alzheimer's disease contribute to late neurodegeneration in the nucleus basalis of Meynert.
26720342 C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a.
26692143 Results indicate that EGR-1 is a transcriptional regulator of MTCH1 and give some clues about the cellular processes in which MTCH1 might participate.
26573109 EGR-1 overexpression in Jurkat cells transfected to express Tax, promoted the activation of several genes, especially those that contained AP-1 (Jun/c-Fos), but knockdown of endogenous EGR-1 by siRNA reduced Tax-mediated JNK-1 transcription.
26538827 mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes
26519755 study provides evidence that hTERT overexpression is responsible for the upregulation of the cysteine protease cathepsin D by regulating EGR-1 to activate invasiveness in cancer progression
26502071 These kinetic data with calf thymus DNA as a competitor suggested that there are millions of high-affinity quasi-specific sites for Egr-1 among the 3 billion bp of genomic DNA.
26498686 Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines.
26324943 analysis of how Egr-1 (Zif268) and its nuclease derivatives has kinetic and thermodynamic roles; there is a dynamic conformational equilibrium between two modes during the DNA-scanning process
26206332 Egr1 depletion delayed the growth of heterotopically implanted GL261 and HCT116 tumors.
26134032 H/R activates ROS/Egr-1 signaling pathway in H9c2 cells, and JNK activation plays an important role in this pathway
26120956 IL-33-ERK/JNK/p38/Egr-1/TSLP axis involved in allergic skin Th2 inflammation
26115646 EGR-1 plays a critical role in LTD4-induced cytokine transcription in Hodgkin cell lines
26113112 Suggest role for Egr1 in regulating the expression of aneurysm related genes.
26109509 Data show that that the nanopore can detect and discriminate both specific and nonspecific binding conformations of early growth response 1 protein zif268 on DNA.
26011708 Here, we demonstrate that EGR1 interacts with MEF2A and is a potent and specific repressor of MEF2 transcriptional activity.
25997867 delta-tocotrienol-induced apoptosis in pancreatic cancer cells to EGR-1 regulation of Bax expression. Forced expression of EGR-1 induces Bax expression and apoptosis in pancreatic cancer cells.
25753664 Caveolin 2 disengages repressed Egr-1 and JunB promoters from lamin A/C through disassembly of H3K9me3 in the inner nuclear membrane.
25740602 Low EGR1 expression is associated with acute lymphoblastic leukemia.
25737480 Human EGR1 expression correlates with genes for endoplasmic reticulum stress and anti-apoptosis.
25725290 Egr1 is able to regulate miRNA activity of miR-125a-3p in human cells through binding TRBP, which highlights an unexpected function of Egr1 in miRNA pathway.
25724735 An important new role of EGR1 in viral infection provide new insight into the novel mechanism underlying the regulation of EV71 replication.
25710185 High EGR1 expression was seen in 67.3% of laryngeal and hypopharyngeal squamous cell carcinomas. High expression in LHSCC chemoradiotherapy patients was associated with higher larynx-preservation survival. Knockdown inhibits radiation-induced apoptosis.
25673149 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines
25658856 Data shows that EGFR1 expression level was increased only in fibroblasts and peripheral blood cells of patients with schizophrenia suggesting that it can be a helpful marker in the differential diagnosis of major psychoses.
25645941 Resveratrol treatment promotes an upregulation of Egr-1 expression and activity in HEK293 cells.
25638726 Deregulation of EGR-1 and/or DUSP-1 in nasal epithelium could be responsible for the prolonged activated transcriptional state observed in vivo in allergic disease.
25637490 Study indicated that ischemia-induced EGR1 expression may exaggerate brain injury by reducing BDNF expression
25613138 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25613134 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25502753 Authors provide evidence that early growth response-1 (Egr-1) activation in endothelial cells is involved in the angiogenic activity of colorectal cancer cell-derived EVs.
25486203 The results suggest that Egr1 may be essential for embryo implantation and decidualization.
25256120 present a novel signalling mechanism by which IL-17A can induce Egr-1-dependent psoriasin expression via the ERK pathway in keratinocytes
25224321 Results show that the effect of EGR-1 on the growth of prostate cells may occur through multiple mechanisms, but be independent of p53 expression control.
25192965 one specific Egr-1 binding site was identified at nt-451/-419 and PLCB1 promoter activity was increased more than 5-fold
25108236 EGR1 plays an important role in up-regulation of mPGES-1 expression by hepatitis B virus X protein in hepatocellular carcinoma tissue.
25031707 Our data suggested that upregulated Egr1 might partially contribute to the emergence of androgen-independent prostate cancer after prolonged androgen deprivation treatment
25029911 These results demonstrate that Egr-1 regulates NGX6 gene transcription through an overlapping Sp1/Egr-1 binding site as a positive regulator of NGX6 gene.
25028509 EGR1 transcription was not induced in HEK293T cells lacking endogenous MEK activity, but overexpression of exogenous constitutively active MEK in HEK293T cells resulted in increased basal and AAR-induced EGR1 expression
24990820 KRT18 expression is directly regulated by EGR1, and contributes to decrease malignancy of non-small cell lung carcinoma.
24925061 our results demonstrate that ciglitazone inhibits PDK1 expression through AMPKalpha-mediated induction of Egr-1 and Egr-1 binding to the specific DNA site in the PDK1 gene promoter, which is independent of PPARgamma
24841508 INF-gamma may sensitize HNSCC cells to chemotherapy-induced apoptosis and necroptosis through up-regulation of Egr-1
24819335 the data presented here provide an explanation for epithelial-to-mesenchymal transition of hypoxic renal tubular cells through the upregulation of Egr-1.
24787739 These results confirm the presence of EGR1 in the nucleolus and point to a role for EGR1 in the control of nucleolar metabolism.
24742676 Data indicate that fat-specific protein 27 (FSP27) increases the inhibitory effect of transcription factor Egr1 on the adipose triglyceride lipase (ATGL) promoter.
24704156 PTEN was upregulated by BCA treatment or EGR1 overexpression.
24657079 molecular determinants of a key protein-DNA interaction
24619556 In hepatocytes, E2F1 activates early growth response (Egr)-1 promoter which is repressed by small heterodimer partner (SHP) and EIA-like inhibitor of differentiation (EID)1
24603130 early growth response protein 1 is one of the key transcription factors in extremely low-frequency electromagnetic field- induced neuronal differentiation
24451137 Overexpression of Egr-1 induces Siva-1 transcription and apoptosis in cardiac fibroblast cell line.
24436125 the substitution of H382 residue with other amino acids faithfully restores salt-dependent binding of EGR1 to DNA in a canonical fashion.
24410631 SNAIL expression was attenuated by knockdown of EGR-1, but upregulated by ectopic expression of EGR-1.
24384380 Shikonin induces cell cycle arrest in human gastric cancer by Egr1-mediated p21 gene expression.
24376510 These data indicate that the acid-dependent NHE2 stimulation is implemented by transcriptional upregulation of NHE2 via acid-induced Egr-1 in the intestinal epithelial cells.
24337575 Both IKKbeta activity and EGR-1 expression are required for the increased IL-8 expression induced by proteasome inhibition in ovarian cancer cells.
24297681 Positive expression of Egr-1 was significantly associated with age, lymphovascular invasion, lymph node and distant metastasis, tumor stage and poor survival.
24190424 overexpression of Egr-1 decreased c-Abl activity independent of endogenous Egr-1 inhibition by siRNA-Egr-1.
24106272 in vivo biochemical or genetic inhibition of NFATc2 activity in megakaryocyte diminishes platelet CD40L implicates the NFATc2/EGR-1 axis as a key regulatory pathway of inflammatory and immunomodulatory activity in platelets
24098051 These findings demonstrate that ribosomal stress-induced ATF3 is a critical regulator in the convergent pathways between EGR-1 and NF-kappaB, which contributes to the suppression of Nod2-activated proinflammatory gene expression.
24077187 EGR-1 was observed in the center node of the regulatory network, which seems to play a role in the process of lung cancer metastasis.
24076422 These results indicate that a major pathway in the target association process for the Egr-1 zinc-finger protein is the one involving intersegment transfer to a nonspecific site and the subsequent sliding to the target.
24012056 The Egr-1 and Atg16L1 genes' polymorphisms were significant risk factors for susceptibility to chronic obstructive pulmonary disease (COPD) . These results demonstrate that autophagy regulator genetic mutations are associated with COPD in male smokers.
24011795 Egr-1 is associated with human gastric cancer progression through the alteration of tumor cell behavior, such as migration and invasion.
24001789 Zinc oxide nanoparticles might induce inflammatory response via human keratinocyte pathway.
23945289 Findings demonstrate that EGR1 is a key player in the transcriptional control of miR-20b, and miR-20b may in turn function as an oncogene by contributing to breast tumorigenesis via tumor suppressor targeting.
23874821 Egr-1 played a critical role in silica-induced pulmonary fibrosis in an ERK1/2, P38 MAPKs-dependent manner, which suggests Egr-1 is an essential regulator in silicosis.
23857582 Heterogeneous nuclear ribonucleoprotein (HnRNP) K genome-wide binding survey reveals its role in regulating 3'-end RNA processing and transcription termination at the early growth response 1 (EGR1) gene through XRN2 exonuclease.
23802749 Egr-1 evoked an increased GNA11 transcription.
23755764 EGR1 expression was not altered in gastric adenocarcinoma or metastatic lymph node tissues.
23718776 His382 inserts into the major groove of DNA, and stabilizes the EGR1-DNA interaction via both hydrogen bonding and van der Waals contacts.
23717422 Sanguinarine effectively increased the activation of the early growth response gene-1 (Egr-1).
23715767 Transcription of the p21Waf1/Cip1 and JNK-1 genes is affected by inhibition of the early growth response-1(Egr-1).
23696025 The PAK5-Egr1-MMP2 signaling pathway is a critical regulator of cell migration and invasion in lung cancer cells.
23632636 Our results demonstrate that lipotoxic insults induce inflammation in placental cells via activation of JNK/EGR-1 signaling.
23592216 In EBV-positive Hodgkin's lymphoma LMP2A-expressing HRS cells lacking BCR signalling functions cannot induce EGR1 and are consequently protected from entry to the virus lytic cycle.
23478574 Paclitaxel induces multidrug resistance (MDR)1 expression, possibly illuminating a potential target pathway for the prevention of MDR1-mediated drug resistance.
23468057 Data indicate that verexpression of Egr-1 induced a significant decrease in the basal levels of TRAIL.
23433111 Three Egr-1-binding sequences (EBSs) were located at -1031, -1005, and -385 within the enhancer region of the BRCA1 gene.
23416169 NAB2 and EGR-1 exert opposite roles in regulating TRAIL expression in human Natural Killer cells.
23409769 Hypoxia-induced expression of TF in human breast cancer cells depends on Egr-1 and HIF-1alpha, and both of these proteins may play an important role in breast cancer metastasis, either directly or indirectly through the TF pathway.
23373701 These results suggest that D2R activation induces a Gbetagamma- and extracellular signal-regulated kinase 1/2-dependent increase in the level of Zif268, which functions to directly up-regulate the expression of GDNF.
23363221 LMP1 induces AID up-regulation and genomic instability via Egr-1.
23178451 BCA induces prostate cancer cell death via EGR1 upregulation and nuclear translocalization, followed by activation of proapoptotic target genes.
23152075 These findings demonstrate that Egr-1 is implicated in glucose deprivation-induced necrosis and tumour progression.
23142458 Data indicate that measurement of EGR1 gene expression in response to rHuEPO in UT-7/EPO cells offers a rapid, non-radioactive and automatable alternative for the detection of rHuEPO neutralizing antibodies (NAbs).
23127556 It was shown that posttranscriptional control of Egr-1 expression requires the RNA-binding protein HuR. It was also shown that the Egr-1 3' UTR mediates posttranscriptional regulation of Egr-1 by HuR.
23121767 A novel signal pathway involved in gastrin-stimulated AE2 expression mediated by EGR1 in gastric cancer cells.
23103837 Important new insights into the temporal regulation by ethanol oxidation of Egr-1 and cellular steatosis.
23029358 Bioinformatics assessment revealed a correlation between p300, EGR1 and MAML1 copy number and mRNA alterations in renal clear cell carcinoma and p300, EGR1 and MAML1 gene alterations were associated with increased overall survival.
22918686 Egr-1 might contribute to gastric cancer proliferation and invasion through activation of the beta-catenin signaling pathway.
22912725 Egr1 activates HGF-induced cell invasion through the regulation of MMPs in HCC cells and heparin inhibits HGF-induced cellular invasion via the downregulation of Egr1
22878149 Egr-1 plays an important role in regulating the HO-1 production induced by ischemia-reperfusion (IR). Downregulation of Egr-1 expression might be one of the mechanisms whereby ischemic postconditioning confers protection against pulmonary IR insult.
22832523 Methylation status of the NGFI-A gene of adolescent children is influenced by their mother's experience of intimate partner violence (IPV) during pregnancy; methylation of the mother's glucocorticoid receptor gene was not affected by IPV.
22721276 Egr-1 expression is significantly increased in patients with cachexia and cancer.
22713211 FH535 blocked the expression of early growth responsive protein 1 (EGR-1) target genes, fibronectin and phosphatase and tensin homologue, without affecting EGR-1 nuclear accumulation in bronchial epithelial cells.
22659570 a crosslink between Egr-1 and periostin in cancer cells
22634339 EGR-1 regulates pro-inflammatory NF-kappaB activation by LPS via PPARgamma although EGR-1 is a positive mediator of chemokine expression following ribosomal insult in intestinal epithelial cells.
22531302 Overexpression of fibroblast growth factor receptor 3 is associated with nonepithelial ovarian cancer.
22508482 Results provide evidence that Egr-1 is a mediator that is involved in the EGF-induced downregulation of E-cadherin and increased cell invasion in ovarian cancer.
22455954 Down-regulation of PPARgamma expression by IL-1 requires de novo protein synthesis and is concomitant with induction of Egr-1.
22433566 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22431919 p130Cas signaling induces the expression of EGR1 and NAB2
22428032 Elevated Egr-1 expression activates lytic genes in Kaposi's sarcoma-associated herpesvirus-infected cells
22354777 When the histone H3 nonphosphorylatable mutant of serine 10 (S10A) was overexpressed in cells, arsenite induction of FOS, EGR1 and IL8 expression was significantly decreased as compared with wild-type cells.
22344601 Intracoronary delivery of DNAzymes targeting human EGR-1 reduces infarct size following myocardial ischaemia reperfusion.
22316125 EGR1 knockdown decreases the gene expression of growth factors and cytokines in mesenchymal stem cells.
22198386 Data demonstrate that induction of EGR1 involves ERK-mediated down-regulation of microRNA-191 and phosphorylation of the ETS2 repressor factor (ERF) repressor, which subsequently leaves the nucleus.
22140445 Chronic hypoxia induces Egr-1 via activation of ERK1/2 and contributes to pulmonary vascular remodeling.
22127986 EGR-1 is deregulated in tumor and structurally intact adjacent prostate tissues and defines field cancerization.
22115966 Results suggest that EGR-1 may stimulate prostate cancer cell growth through up-regulation of IGF-1R and indicate that down-regulation of EGR-1 could be an effective therapeutic approach against prostate cancer.
22095683 tumor promoter induces RON expression via Egr-1, which, in turn, stimulates cell invasiveness in AGS cells
22053691 acquired knowledge on transcriptional regulation of Egr-1 is not entirely understood. In this review, we highlight upstream and downstream signaling in vitro and in vivo associated with Egr-1
21998680 SUMO-1 modification improving EGR1 ubiquitination is involved in the modulation of its stability upon EGF mediated induction
21995436 Egr-1-dependent induction of Cyr61 may contribute to premature skin ageing by smoking.
21968973 NKX2-3 may play different roles in ulcerative colitis and Crohn's disease pathogenesis by differential regulation of EGR1.
21931594 Egr-1 induces a distinct profibrotic/wound healing gene expression program in fibroblasts
21791614 Our study illustrates a central role of p300-acetylated ATF5 in ATF5-dependent Egr-1 activation
21743958 The results suggest that Egr-1 may promote prostate cancer development by modulating the activity of factors NF-kappaB and AP-1, which are involved in cell proliferation and apoptosis.
21743491 Data show a crosstalk between mPGES-1/PGE(2) and EGR1/beta-catenin signaling that is critical for hepatocarcinogenesis.
21725089 control network for Egr-1 expression through a feedback loop between SHP and HNF4alpha.
21688838 Findings on the function of the arginine residue in the third zinc finger domain of Zif268 may be useful for the design of novel artificial zinc finger proteins.
21617851 overexpression of EGR-1 selectively increased AP-1 and NF-kappaB activation.
21596316 p53 and EGR1 play the role in two phases of mitogenic signaling in mammary epithelial cells exposed to EGF.
21551235 Removal of regions upstream of the SRE 1 or 2 sites led to a dramatic reduction in Egr-1 promoter activity & response to IGFBP-3 expression. Loss of all 5 SRE sites & 2 CRE sites led to a total elimination of Egr-1 promoter activity.
21506108 Induction of Id-1 by FGF-2 involves activity of EGR-1 and sensitizes neuroblastoma cells to cell death.
21489990 Egr-1 is an in vivo regulator of tau phosphorylation and suggest that in AD brain increased levels of Egr-1 aberrantly activate an Egr-1/Cdk5/PP1 pathway, leading to accumulation of hyperphosphorylated tau, thus destabilizing the microtubule cytoskeleton.
21479245 These data define serum response factor as a host cell transcription factor that regulates immediate early gene expression in Toxoplasma-infected cells.
21436631 The study suggests a connection between CD133 and EGR1 and emphasises the importance of the EGR1/TCF4/CD133/LGR5 network in colorectal cancer.
21419860 nuclear translocation involves importin-7
21368226 Egr-1 expression is upregulated in rat and human astrocytes exposed to HIV-1 Tat protein in vitro.
21368226 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21365018 The HMGB1/RAGE/OPN/Egr-1 pathway may be involved in inflammatory, angiogenic and fibrotic responses in proliferative vitreoretinal disorders.
21354100 Chlorination of high-density lipoprotein induced phosphorylation of p42/44 mitogen-activated protein kinase, expression of transcription factor early growth response 1 and enhanced expression of heme oxygenase-1 in human endothelial cells.
21336263 The absence of ERG rearrangement in bladder or lung small cell carcinomas highlights the utility of detecting ERG rearrangement in small cell carcinomas of unknown primary for establishing prostatic origin.
21321112 the Egr-1/GGPPS/Erk1/2 pathway is responsible for insulin resistance during hyperinsulinism
21297666 found that E-cadherin negatively regulates tumor cell growth, in part, by positively regulating PTEN expression via beta-catenin-mediated Egr1 regulation, thus influencing PI3K/Akt signaling
21224049 these results reveal a new EGR-1/GGPPS/MAPK signaling pathway that controls cigarette smoke-induced pulmonary inflammation.
21212994 Glucose and TNF-alpha increased Egr-1 expressionvia ERK1/2 activation in endothelial cells.
21189327 results reveal that miR-199a and Brm form a double-negative feedback loop through Egr1, leading to the generation of two distinct cell types during carcinogenesis.
21160498 SAMD9, an IFN-gamma-responsive protein, interacts with RGL2 to diminish the expression of EGR1, a protein of direct relevance to the pathogenesis of ectopic calcification and inflammation.
21118966 Data show that miR-183 has a potential oncogenic role through the regulation of 2 tumor suppressor genes, EGR1 and PTEN, and the deregulation of this fundamental miRNA regulatory network may be central to many tumor types.
20945384 CXCL5/ENA78 increased cell migration and epithelial-to-mesenchymal transition of hormone-independent prostate cancer by early growth response-1/snail signaling pathway.
20864524 Kaposi's sarcoma-associated herpesvirus-encoded glycoprotein B promotes virus latency by regulating expression of cellular Egr-1.
20862322 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20811575 Performed ChIP-Seq to find the targeting microRNA genes of Egr1, in K562 cells. Found Egr1 binding sites near the promoters of 124 distinct microRNA genes, accounting for about 42% of the miRNAs which have high-confidence predicted promoters.
20690147 In vivo EGR1 binding sites were identified in phorbol 12-myristate 13-acetate-treated K562 cells.
20621662 Downregulation of transforming growth factor beta receptor-II expression by cigarette smoke-induced Egr-1 may contribute to smoking-induced premature skin aging.
20585888 Data show that co-expression of ZNF300 and Egr1 lead to enhanced IL-2Rbeta promoter activity, and suggest that ZNF300 is another regulator of the human IL-2Rbeta promoter.
20578042 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20507991 a novel mechanism by which an extracellular signal initiated by RAGE ligand AGEs regulates Egr-1 in a manner requiring mDia-1
20506119 Results suggest that in many cells of neuroectodermal and epithelial origin EGR1, EGR2, and EGR3 activate NAB2 transcription which is in turn repressed by NAB2, thus establishing a negative feedback loop.
20489156 Data suggest that EGR-1 plays important roles on VEGF-A expression in lung cancer cells, and epigenetic silencing of transactivator(s) associated with NAB-2 expression might also contribute to upregulate VEGF-A expression.
20448047 Study provides a new therapeutic target, Egr-1, for attenuation of elevated leukotriene levels in patients with sickle cell disease and other inflammatory diseases.
20414733 these results reveal that Tat directly transactivates Egr-1 expression
20414733 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20403028 results indicate that aberrant expression of EGR1 in gastric cancer is associated with tumor invasion and metastasis, and heparanase transcription
20372793 thymidine phosphorylase has a role in the induction of early growth response protein-1 and thrombospondin-1 by 5-fluorouracil in human cancer carcinoma cells
20363028 Data show that neutrophils constitutively express EGR-1 protein.
20348948 EGR1 is required for the ability of TBX2 to repress NDRG1 and drive cell proliferationin breast cancer.
20204305 Human SK-BR3 and MCF-7 breast carcinoma cell growth and capacity of anchorage transfected with siRNA-Egr-1 or treated with camptothecin was slower than that of the control group
20190820 Overexpression of Egr-1 is caused by mutation of p53 and appears to be initiated through activation of the MEK/ERK1/2 signaling cascade by mutant p53.
20144677 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20121949 Snail associates with EGR-1 and SP-1 to mediate TPA-induced transcriptional upregulation of p15(INK4b) in HepG2
20087343 Egr-1 drives c-FLIP expression and the short splice variant of c-FLIP (c-FLIP(S)) specifically inhibits DR5 activation.
20053757 15(S)-HETE-induced angiogenesis requires Src-mediated Egr-1-dependent rapid induction of FGF-2.
20018936 IL-1beta induction of EGR-1 transcription involves histone H3 phosphorylation, acetylation, and autoregulation by EGR-1.
20016208 P. gingivalis antigens and IL-6/sIL-6R stimulated Egr-1 and MCP-1 expression in coronary artery endothelial cells.
20009530 Studies demonstrated that EGR1 is involved in regulating homeostasis of hematopoietic stem cells (HSC) by coordinating proliferation and migration.
19940138 Data show thatiInjury- and shear-inducible c-Jun controls early growth response-1.
19915002 the first evidence that Egr-1 protein is differentially expressed in Th1 and Th2 cells and is involved in the acute phase of the IL-4 transcription in response to T cell receptor stimulation
19913601 Knockdown of Egr-1 by expression of small interfering RNA attenuated EGF-induced Klotho promoter activity.
19888474 Nab2 is a novel endogenous negative regulator of Egr-1-dependent TGF-beta signaling responsible for setting the intensity of fibrotic responses
19885607 Egr-1 downregulation by siRNA inhibits growth of human prostate carcinoma cell line PC-3
19878561 Egr-1 protein expression is associated with disease progression in human bladder cancer.
19837979 JUN overexpression in multiple myeloma cells induced cell death and growth inhibition and up-regulated expression of early growth response protein 1.
19837667 Data show that EGR-1 knockdown inhibited gene transcription and production of IL-8 by a human prostate cancer cell line, and that silencing EGR-1 suppressed a synergistically functional interaction between EGR-1 and NF-kappaB.
19833116 We showed high levels of Egr-1 mRNA expression and demonstrated a significant association of polymorphism with increased plasma total IgE and atopy in AR patients
19833116 Observational study of gene-disease association. (HuGE Navigator)
19822898 Data show that VEGFR1 promoter binding sites for ELF-1, CREB and EGR-1/3 play a positive role in gene transcription in endothelial cells.
19786090 Egr1 is a novel regulator of stathmin expression and p53 mediates the transcriptional repression of stathmin by Egr1 in human lung cancer cells.
19781349 The activation of EGR-1 mediated by p38MAPK pathway plays a critical role in epirubicin resistance of human breast carcinoma cells.
19765320 Flt3 ligand transcriptional control is targeted by fluorouracil-induced Egr-1 promoter in hematopoietic damage
19747485 Regulated WT1 followed by sequential Egr1 and Sp1 binding to elements within Prm1 mediate repression and subsequent induction of TPalpha during differentiation into the megakaryocytic phenotype.
19724854 pcDNA3.1-Egr-1-TRAIL recombinant plasmid can sensitize SW480 cells to radiation
19526316 Egr-1 might play an important role in the up-regulation of VEGF and IL-8 induced by HGF and contribute to HGF-mediated angiogenesis, which might be promising targets for hepatocellular carcinoma therapy.
19467232 ERG1 may loop the distal enhancer PB responsive enhancer module towards the proximal OA response element KI so that together, CAR and HNF4alpha synergistically activate the CYP2B6 promoter.
19446747 Fluorescence in situ hybridization using a probe of EGR1 is able to detect a cryptic deletion in a patient with myelodysplastic syndrome.
19435811 Results indicate that EGR-1 and nuclear factor-kappaB mediate GRO/CXCR2 proliferative signaling in esophageal cancer and may represent potential target molecules for therapeutic intervention.
19432968 Thrombin induced a robust and transient biosynthesis of Egr-1.
19426596 Data suggest that Flt3 Ligand(FL) gene regulated by Egr-1 promoter can protect hematopoiesis from 5-Fu injury.
19374776 Observations of in vivo occupancy changes of EGR-1 and SP1 suggest that several types of interplay between EGR-1 and other proteins result in multiple responses to EGR-1 downstream genes.
19307576 IL-10 expression may be regulated by miR-106a, which is in turn transcriptionally regulated by Egr1 and Sp1
19307156 these findings provide molecular insight into T-bet transcription and suggest that EGR1 is an upstream regulator of T-bet induction.
19276347 E2F1 activated the expression of transcription factor EGR1 for promoting cell survivalin prostate cancer.
19261809 TNF-alpha abrogated TGFbeta1-induced SMalphaA gene expression at the level of transcription without disrupting phosphorylation of regulatory Smads.
19245972 The present study demonstrates the differential up-regulation of Egr-1 in the thrombus-covered wall of human Abdominal Aortic Aneurysm (AAA) and also suggests its possible contribution to the thrombogenic and inflammatory pathogenesis in human AAA.
19152168 thalidomide could suppress leukemia cell invasion and migration by upregulation of Egr-1
19131339 Mutation of Sp1 and Egr1 binding sites within the essential region diminished Fyn promoter activity and identified Egr1 as conferring redox sensitivity.
19115247 HDAC4 contributes to transcriptional induction of mPGES-1 by IL-1 through a mechanism involving up-regulation of Egr-1 transcriptional activity
19112164 Early growth response-1 regulates angiopoietin-1-induced endothelial cell proliferation, migration, and differentiation.
19074849 activation of ESE-1 via enhanced nuclear translocation mediates tolfenamic acid-induced EGR-1 expression, which plays a critical role in the activation of apoptosis
19074480 we show a strong association between endoglin and EGR-1, increased collagen and Ssmooth muscle cells expression, decreased levels of intraplaque thrombosis
19050264 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19032775 Results indicate that M12 cells undergo Egr1-dependent apoptotic response upon UV stimulation and led to the identification of downstream targets of Egr1, which mediate epidermal growth factor receptor function.
18989526 Report phorbol 12-myristate 13-acetate responsive sequence in Galphaq promoter during megakaryocytic differentiation. Regulation by EGR-1 and MAP kinase pathway.
18842581 PGE(2) via EP(4) activates the EGFR --> ERK1/2 --> Egr-1 pathway, leading to increased Id-1 transcription and cell invasion
18830406 demonstrate a critical role for Egr-1 in promoting autophagy and apoptosis in response to cigarette smoke exposure in vitro and in vivo
18780286 growth factors and serum induce expression of Egr-1 and SRF, respectively, which in turn induces E2-EPF UCP expression that positively regulates cancer cell growth
18772333 These findings define a Smad-independent TGF-beta signal transduction mechanism that underlies the stimulation of Egr-1.
18711316 DIDS-sensitive Cl- channels play a key role in the Low-density lipoprotein-induced cell proliferation of human aortic smooth muscle cells via the activation of Erk1/2 and PI3K/Akt and the upregulation of Egr-1.
18704310 The expression of EGR-1 mediated by p38MAPK pathway plays a critical role in paclitaxel resistance of ovarian carcinoma cells.
18682391 Histamine-induced Egr-1 expression is dependent on the activation of the H1 receptor, and rapidly and transiently activates PKCdelta, ERK1/2, p38 kinase, and JNK prior to Egr-1 induction.
18675783 The role of the Early Growth Response-1 transcription factor in TNFalpha autoregulation in HaCaT human keratinocytes was investigated.
18636116 No pathological mutations were detected upon sequencing of the coding regions and the adjacent intronic regions of EGR1 in 96 unrelated Chinese subjects with high myopia.
18636116 Observational study of gene-disease association. (HuGE Navigator)
18604866 the basal activity of the human PRDM1 promoter, through which several factors, including SP1, SP3 and early growth response 1, modulate its expression through a conserved GC-box.
18583706 EGR1 is an important transcriptional stimulator of the human PCYT2 and that conditions that modify EGR1 also affect the function of ECT and consequently PE synthesis
18525291 Sp1/Egr1-repeat polymorphism in the ALOX5 promoter is not a genetic marker for the risk of developing late-onset Alzheimer disease
18515748 After high glucose stimulation, AhR was found in complex with Egr-1 & activator protein-2.
18507785 association of Egr-1 polymorphisms with plasma total IgE and atopy in asthmatic children
18507785 Observational study of gene-disease association. (HuGE Navigator)
18489490 findings show EGR-1 was mainly restricted to tumor cells expressing NMDA-R & significantly upregulated in astrocytic tumors compared to normal brain; EGR-1 expression was significantly associated with enhanced patient survival in high grade astrocytomas
18469860 Activation of BAG3 by Egr-1 in response to FGF-2 in neuroblastoma.
18460021 Egr-1 plays an important regulatory role in the transcriptional activation of hTERT.
18435749 EGR1 gene is implicated in idiopathic absence epilepsy.
18434089 ATP activated MAPKs through the P2Y2 purinoceptor/PLC/PKC/ERK signaling pathway and induced translocation of ERK1/2 into the nucleus.
18434015 the early growth response 1 gene is repressed by Elk1 in normally cycling SH-SY5Y neuroblastoma cell line
18324520 APE1 regulated PTEN expression is mediated by Egr-1.
18316600 ERK and JNK MAPK/Elk-1/Egr-1 signal cascade is required for p53-independent transcriptional activation of p21(Waf1/Cip1) in response to curcumin in U-87MG human glioblastoma cells
18303024 CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene
18281687 Transcriptional activation of the EGR-1 promoter by JNK-MKK7 or by IL-1 required a single upstream AP-1 site and three distal serum-response elements (SRE).
18247371 Data demonstrate that a decrease in the level of Egr-1, one of the targets for MAPK, by Tat has a negative impact on the level of p35 expression in NGF-treated neural cells.
18247371 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18215136 Hepatocyte growth factor stimulates 5alpha-R1 expression through up-regulation of the transcription factor early growth response 1
18204200 These results suggest that Egr-1 may be an important breast cancer marker and that an as yet uncharacterized pathway involved in Egr-1 and gelsolin expression exists which leads to breast cancer cell development.
18174470 Prolonged exposure to heme, as may be observed after plaque rupture in atherosclerotic disease, leads to dysregulation and prolonged elevated Egr-1 expression that contributes to atherosclerotic progression
18171299 The greatest reduction in the number of C. pneumoniae inclusions was due to the silencing of the gene coding for the transcription factor early growth response 1, which decreased the number of inclusions by 38.6%
18088351 Antithrombin might inhibit LPS-induced production of TNF-alpha by inhibiting the increase in Egr-1 expression in monocytes via interaction with heparin-like substances expressed on the cell surface
18068676 Intact SP1-binding sites are essential for promoter activity, whereas EGR-1 suppresses the transcription of the human SREBP-1a promoter
18067864 These results suggest that elevated expression and activity of PLD attenuate phorbol myristate acetate-induced Egr-1 expression via PI3K pathway.
18027854 Egr-1 negatively regulates survivin expression and sensitizes cell lines to TRAIL-induced apoptosis
17986608 defect in upregulation of p57Kip2 transcription is due to reduced levels of EGR1 caused by direct, destabilizing interaction with PAX3-FOXO1
17975260 These results indicate that EGR1 is a key player in coordinated down-regulation of genes in leiomyoma.
17967787 Hemin increased Egr-1 expression (mRNA, protein) within 30 minutes and ERK-1/2 phosphorylation and nuclear translocation within 5 minutes
17932312 Activated protein C may provide cytoprotective activity by activating the ERK pathway, which upregulates EGR-1 thereby suppressing the expression of TRAIL by PAR-1/S1p1 dependent but EPCR independent mechanism.
17671831 Calcipotriol affects proliferation of keratinocytes by decreasing the expression of EGR1 and PLK2.
17631291 Results reveal that egr-1 is a target gene of PGE(2) in HCA-7 cells and is regulated via the newly identified EP4/ERK/CREB pathway.
17631285 Our data demonstrate that IL-1beta-induced Id2 expression in VSMC is mediated by the transcription factor Egr-1 in VSMC.
17599039 Constitutive expression of Egr-1 transgene abrogates E2F-1 oncogene-mediated block in differentiation of murine myeloblastic leukemia cells, allowing the cells to differentiate into functionally mature macrophages that subsequently undergo apoptosis.
17581316 STI571 influence through inducing urokinase-type plasminogen activator and interleukin-8, in which the induction of early growth response-1 expression and extracellular signal-regulated kinase 1/2 phosphorylation might be involved.
17559061 Radiofrequency radiation (900 MHz) induces EGR1 gene expression and affects cell-cycle control in human neuroblastoma.
17516844 reveal a novel role for protein phosphatase 1 inhibitor in the regulation of the tumor suppressor gene EGR1 via activation of the MEK-ERK MAPK pathway
17502875 Can repress herpes simplex virus (HSV) type 1 immediate-early gene expression, and thus may play a critical role in HSV-1 gene silencing during latency and reactivation.
17494953 The MAPK-EGR-1-HSP70 pathway regulates the cigarette smoke-induced inflammatory process.
17448597 EGR1 is upregulated after radical prostatectomy for prostatic neoplasms.
17420284 Haploinsufficiency for Egr1plays a role in the development of acute myeloid leukemia and myelodysplastic syndromes characterized by abnormalities of chromosome 5.
17257596 cDNA microarray analysis revealed that expression of early growth response gene-1 (Egr-1) was increased by LMP1 expression in MCF7 and Jurkat cells.
17099140 The identification that induction of MMP-2 and MT1-MMP by CSE from lung fibroblasts is EGR-1-dependent reveals a molecular mechanism for matrix remodeling in cigarette smoke-related emphysema.
16995904 GTP-Binding Protein alpha Subunits, Gq-G11, gene is regulated during megakaryocytic differentiation by EGR-1.
16858414 These findings indicate that Snail upregulation by HGF is mediated via the MAPK/Egr-1 signaling pathway and that both Snail and Egr-1 play a critical role in HGF-induced cell scattering, migration, and invasion.
16831524 EGR1 regulates TOPBP1 gene transcription.
16741963 Expression of Tat decreased NGF-induced Egr-1 levels in neuroblastoma cells.
16702209 EGR-1 is induced by transforming growth factor-beta and mediates stimulation of collagen gene expression
16552541 The IGFBP3, hRas, JunB, Egr-1, Id1 and MIDA1 genes were up-regulated in psoriatic involved skin compared with uninvolved skin.
16464174 Transcriptional stimulation of the human NHE3 promoter activity by PMA: PKC independence and involvement of the transcription factor EGR-1.
16393964 Overexpression of Egr-1, but not Egr-3, is capable of augmenting transcription of an intact CD154 promoter.
16382041 Nkx3.1 and Egr1 regulate gene programs involved in distinct aspects of prostate tumorigenesis [review]
16260776 Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter in a negative feedback loop
16093249 EGR1 regulates heparanase transcription in tumor cells and importantly, can have a repressive or activating role depending on the tumor type
16091742 c-Abl promotes the induction of EGR1 through the MEK/ERK pathway in regulating apoptotic response to oxidative stress.
16079301 this is a novel first report demonstrating that the expression of ATF3 occurs via early growth response gene-1 downstream of extracellular signal-regulated kinase1/2
16007175 EGR1 expression in combination with promotor CpG methylation regulates heparanase expression
15999367 The EGR1 gene appeared to be deleted in ER-negative human breast carcinomas. Egr-1 may contribute to the pathogenesis of ER-negative breast carcinomas versus ER-positive breast carcinomas.
15923644 TNF-alpha-induced CD44 expression was regulated by AP-1 through the activation of the CaMK-II pathway, whereas LPS-induced CD44 transcription was regulated specifically by Egr-1 through JNK activation.
15910736 results show that distal serum response elements within the Egr-1 promoter are of major importance for the inducibility of Egr-1 gene transcription by tetradecanoylphorbol acetate
15875316 finding of FGF2 and EGR1 upregulation in endothelial cell microvascular channels within organising thrombus
15709168 Up-regulation of EGR1 contributed significantly more to heparanase expression than did promoter CpG hypomethylation in prostate cancer samples.
15689620 Data show that ionizing radiation causes stress-induced activation of insulin-like growth factor-1 receptor-Src-Mek-Erk-Egr-1 signaling that regulates the clusterin pro-survival cascade.
15640148 IL-17-stimulated TNF-alpha mRNA expression and promoter activity was dependent on Egr-1 expression.
15611055 the MEK1/ERK1/2 pathway couples the CCK2 receptor to nuclearization and DNA binding of Egr-1
15548700 EGR1 is a significant contributor to mutant p53 gain of function
15545275 Egr-1 has roles in regulating both the basal and LPS-induced activity of the SOCS-1 promoter
15523672 results show that there are genuine Sp1/Sp3 or Egr-1 controlled genes showing no cross-regulation of Sp1/Sp3 and Egr-1 through the same DNA-binding site
15517593 EGR-1 regulates PTEN expression in the initial steps of the apoptotic pathway
15486985 Findings suggest that EGR-1 expression and activity is differentially regulated in prostate cancer cell line PC-3 and BPH-1 cell line.
15449318 Deletion analyses of the Egr-1 promoter identify a minimal estradiol-responsive region of the promoter containing a serum response element which binds Elk-1 and serum response factor.
15231681 Egr-1 may display tumor-suppressing activity and offers a potential target for uterine leiomyoma management.
15225550 Cells induced with serum to increase endogenous Egr1 increase the transcription of p300/CBP only when Egr1 binding sites in the promoter are not mutated, causing the expression of downstream targets of Egr1.
15211096 Review examines emerging evidence that ERG-1 orchestrates transcriptional response to vascular injury.
15155664 Helicobacter pylori induced expression of Egr-1 in gastric epithelial cell lines in a dose-dependent manner, suggesting a role, in part, in Helicobacter pathology
15023995 mPGES-1 and Egr-1 are novel targets of PPARgamma
15003938 Although EGR-1 is induced by PDGF in human airway smooth muscle cells in cell culture, the role of EGR-1 in airway remodeling and asthma remains to be established.
14985468 microtubules regulate EGR-1 localization in benign prostate cells but not in malignant prostate cells
14966901 expression of Egr-1, c-fos and cyclin D1 varies in esophageal precancerous lesions and cancer tissues, suggesting an involvement of these genes in the development of esophageal carcinoma.
14722058 Egr-1-mediated activation of transcription is regulated by mPGES-1 in inflammatory bowel disease
14662774 EGR-1 is required for expression of NAG-1 by troglitazone
14522979 early growth response 1 regulates inducible heparanase gene transcription in activated T cells
12958075 activation of JNK and expression of Egr-1 gene in B lymphoblasts mediate a cellular response to genotoxic agents that may be induced by Fanconi anemia proteins
12947119 study provides strong evidence that early growth response 1 regulates low density lipoprotein receptor transcription via a novel mechanism of protein-protein interaction with CCAAT enhancer-binding protein beta
12890669 EGR1 binds to the androgen receptor (AR) in prostate carcinoma cells, and an EGR1-AR complex can be detected
12872165 study provides the first evidence of the crucial role of Egr-1 in microvascular endothelial cell growth, neovascularization, tumor angiogenesis and tumor growth
12729460 stimulation by ATP via a protein kinase C-dependent pathway in the human osteoblastic HOBIT cell line
12706485 These results suggest that induction of egr-1 may be needed to regulate genes involved in DNA repair, cell survival, and apoptosis.
12690110 Egr1 controls p21Cip1 expression by directly interacting with a specific sequence on its gene promoter.
12637574 Egr-1 represses COL2A1 by preventing interactions between Sp1 and the general transcriptional machinery
12618431 data demonstrates that eukaryotic translation initiation factor 4E binding protein 1 is a new target for early growth response-1
12571843 The enhanced expression of Egr-1 may regulate the activity of matrix metalloproteinases in synovial fibroblasts by enhancing the expression of the TIMP-1, -2, and -3 genes.
12566441 PI3K/ERK signaling by the EP(4) receptors induces the functional expression of early growth response factor-1 (EGR-1)
12553721 upregulation of Egr-1 might contribute to fibrosis observed in rheumatoid arthritis synovium by activation of genes encoding the alpha1 and alpha2 chains of type I collagen
12553019 Egr-1 has a significant role in carcinogenesis and in cancer progression, especially metastasis.
12543866 role of Egr-1 in lipopolysaccharide (LPS) induction of TF and inflammatory mediators in vivo was evaluated using Egr-1(+/+) and Egr-1(-/-) mice
12517959 Overexpression of EGR1 via generation of superoxide anions inhibits the basolateral Na+/K+-ATPase activity of kidney proximal tubule cells.
12507899 Keratinocytes of chronic psoriatic plaques were characterized by enhanced p16, p14(ARF), and p12 expression accompanied by elevated Egr-1 levels
12457461 Data demonstrate that Egr-1, AP1 and Smad are part components of the transforming growth factor beta signal transduction pathway that regulates PPAR gamma expression.
12456801 studies for the first time identify Egr-1 as a nuclear target of gastrin and show that functional interplay of Egr-1, Sp1, and CREB is indispensable for gastrin-dependent CgA transactivation in gastric epithelial cells
12439908 Egr-1 expression and cell apoptosis may have an important biological significance in esophageal carcinogenesis.
12393577 The proximal serum response element in the Egr-1 promoter mediates response to thrombin in primary human endothelial cells. Thrombin does this by a MAPK-dependent mechanism that involves an interaction between SRF & SRE-1.
12384223 transactivation of the EGF receptor as well as stimulation of the mitogen activated/extracellular signal-regulated protein kinase (ERK) are essential for substance P/NK-1 receptor-induced activation of Egr-1 biosynthesis
12235180 Egr1 is the oncostatin M-induced transcription factor that binds to the SIRE sequence of the LDL receptor promoter
12165491 Egr1 translates developmental signals into appropriate changes in gene expression at multiple stages of thymocyte development.
12065847 Egr1 has multiple roles in prostate tumor cell growth and survival, cell differentiation, tumor progression, angiogenesis, and apoptosis.
12011097 Egr-1 is necessary and sufficient to activate human PPARgamma1 gene expression in VSMC
11978801 role in mediating tissue factor expression in endothelial cells induced by CD40 ligand
11956220 Activation of human monoamine oxidase B gene expression by a protein kinase C MAPK signal transduction pathway involves c-Jun and Egr-1.
11925592 Egr-1 gene of transfected HHCC and ECa109 cells showed obvious suppression of the cell growth and malignant phenotypes, but no suppression in SMMC7721 (HCC cell line) cells.
11909874 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter
11909874 The gene expression of early growth response 1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11830539 Early Growth Response-1 gene mediates up-regulation of epidermal growth factor receptor expression during hypoxia
11819815 Egr-1 in the cancer tissue shows down-regulated expression that supports the inhibited function of Egr-1 in cancer growth and suggests Egr-1 may have an important role in gene therapy of esophageal carcinoma.

AA Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGG      1 - 70
GGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLE     71 - 140
PAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFP    141 - 210
TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESR    211 - 280
TQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFS    281 - 350
RSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR    351 - 420
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGF    421 - 490
PSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC                     491 - 543
//

Text Mined References (361)

PMID Year Title
27002148 2016 A Positive Feed-forward Loop Associating EGR1 and PDGFA Promotes Proliferation and Self-renewal in Glioblastoma Stem Cells.
26975996 2016 EGR1 controls divergent cellular responses of distinctive nucleus pulposus cell types.
26792551 2016 MicroRNA-132 and early growth response-1 in nucleus basalis of Meynert during the course of Alzheimer's disease.
26720342 2015 C2238/?ANP modulates apolipoprotein E through Egr-1/miR199a in vascular smooth muscle cells in vitro.
26692143 2016 Early growth response 1 (EGR-1) is a transcriptional regulator of mitochondrial carrier homolog 1 (MTCH 1)/presenilin 1-associated protein (PSAP).
26573109 2016 Activation of Tax protein by c-Jun-N-terminal kinase is not dependent on the presence or absence of the early growth response-1 gene product.
26538827 2015 Downregulation of mPGES-1 Expression via EGR1 Plays an Important Role in Inhibition of Caffeine on PGE2 Synthesis of HBx(+) Hepatocytes.
26519755 2016 Human telomerase reverse transcriptase (hTERT) promotes cancer invasion by modulating cathepsin D via early growth response (EGR)-1.
26502071 2015 Influence of quasi-specific sites on kinetics of target DNA search by a sequence-specific DNA-binding protein.
26498686 2015 Prostaglandins induce early growth response 1 transcription factor mediated microsomal prostaglandin E2 synthase up-regulation for colorectal cancer progression.
26324943 2015 Balancing between affinity and speed in target DNA search by zinc-finger proteins via modulation of dynamic conformational ensemble.
26206332 2015 Silencing Egr1 Attenuates Radiation-Induced Apoptosis in Normal Tissues while Killing Cancer Cells and Delaying Tumor Growth.
26134032 2015 Effect of N-n-butyl haloperidol iodide on ROS/JNK/Egr-1 signaling in H9c2 cells after hypoxia/reoxygenation.
26120956 2015 IL-33 induces Egr-1-dependent TSLP expression via the MAPK pathways in human keratinocytes.
26115646 2015 Early growth response gene (EGR)-1 regulates leukotriene D4-induced cytokine transcription in Hodgkin lymphoma cells.
26113112 2015 Pioglitazone Identifies a New Target for Aneurysm Treatment: Role of Egr1 in an Experimental Murine Model of Aortic Aneurysm.
26109509 2015 Nanopore sensing of individual transcription factors bound to DNA.
26011708 2015 EGR1 Functions as a Potent Repressor of MEF2 Transcriptional Activity.
25999311 2015 Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1.
25997867 2015 EGR-1/Bax pathway plays a role in vitamin E ?-tocotrienol-induced apoptosis in pancreatic cancer cells.
25753664 2015 Insulin-response epigenetic activation of Egr-1 and JunB genes at the nuclear periphery by A-type lamin-associated pY19-Caveolin-2 in the inner nuclear membrane.
25740602 2015 microRNA-181a enhances cell proliferation in acute lymphoblastic leukemia by targeting EGR1.
25737480 2015 Loss of Egr-1 sensitizes pancreatic ?-cells to palmitate-induced ER stress and apoptosis.
25725290 2015 Early growth response gene 1, a TRBP binding protein, is involved in miRNA activity of miR-125a-3p in human cells.
25724735 2015 Early growth response-1 facilitates enterovirus 71 replication by direct binding to the viral genome RNA.
25710185 2015 EGR1 regulates radiation-induced apoptosis in head and neck squamous cell carcinoma.
25673149 2015 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines.
25658856 2015 Altered gene expression in schizophrenia: findings from transcriptional signatures in fibroblasts and blood.
25645941 2015 Resveratrol upregulates Egr-1 expression and activity involving extracellular signal-regulated protein kinase and ternary complex factors.
25638726 2015 EGR-1 and DUSP-1 are important negative regulators of pro-allergic responses in airway epithelium.
25637490 2015 Over-expressed EGR1 may exaggerate ischemic injury after experimental stroke by decreasing BDNF expression.
25502753 2014 Egr-1 activation by cancer-derived extracellular vesicles promotes endothelial cell migration via ERK1/2 and JNK signaling pathways.
25486203 2014 Expression, regulation and function of Egr1 during implantation and decidualization in mice.
25258363 2014 Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
25256120 2014 Egr-1 is a key regulator of IL-17A-induced psoriasin upregulation in psoriasis.
25224321 2014 Association of increased levels of TGF-?1 and p14ARF in prostate carcinoma cell lines overexpressing Egr-1.
25192965 2014 Characterization of the PLCB1 promoter and regulation by early growth response transcription factor EGR-1.
25108236 2014 15d-PGJ? decreases PGE? synthesis in HBx-positive liver cells by interfering EGR1 binding to mPGES-1 promoter.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25031707 2014 Androgen deprivation therapy induces androgen receptor-dependent upregulation of Egr1 in prostate cancers.
25029911 2014 Egr-1 regulates the transcription of NGX6 gene through a Sp1/Egr-1 overlapping site in the promoter.
25028509 2014 A mitogen-activated protein kinase/extracellular signal-regulated kinase kinase (MEK)-dependent transcriptional program controls activation of the early growth response 1 (EGR1) gene during amino acid limitation.
24990820 2014 EGR1 decreases the malignancy of human non-small cell lung carcinoma by regulating KRT18 expression.
24925061 2014 Repression of phosphoinositide-dependent protein kinase 1 expression by ciglitazone via Egr-1 represents a new approach for inhibition of lung cancer cell growth.
24841508 2014 INF-? sensitizes head and neck squamous cell carcinoma cells to chemotherapy-induced apoptosis and necroptosis through up-regulation of Egr-1.
24819335 2014 Egr-1 mediates chronic hypoxia-induced renal interstitial fibrosis via the PKC/ERK pathway.
24787739 2014 The transcription factor EGR1 localizes to the nucleolus and is linked to suppression of ribosomal precursor synthesis.
24742676 2014 Fat-specific protein 27 inhibits lipolysis by facilitating the inhibitory effect of transcription factor Egr1 on transcription of adipose triglyceride lipase.
24704156 2014 EGR1-dependent PTEN upregulation by 2-benzoyloxycinnamaldehyde attenuates cell invasion and EMT in colon cancer.
24657079 2014 Role of promoter DNA sequence variations on the binding of EGR1 transcription factor.
24619556 2014 E2F1 is a novel fibrogenic gene that regulates cholestatic liver fibrosis through the Egr-1/SHP/EID1 network.
24603130 2014 Egr1 mediated the neuronal differentiation induced by extremely low-frequency electromagnetic fields.
24451137 2014 Egr-1 upregulates Siva-1 expression and induces cardiac fibroblast apoptosis.
24436125 2014 Enthalpic factors override the polyelectrolyte effect in the binding of EGR1 transcription factor to DNA.
24410631 2014 Protein kinase C-induced early growth response protein-1 binding to SNAIL promoter in epithelial-mesenchymal transition of human embryonic stem cells.
24384380 2014 Shikonin induces cell cycle arrest in human gastric cancer (AGS) by early growth response 1 (Egr1)-mediated p21 gene expression.
24376510 2013 Extracellular acidosis stimulates NHE2 expression through activation of transcription factor Egr-1 in the intestinal epithelial cells.
24337575 2014 Proteasome inhibition increases recruitment of I?B kinase ? (IKK?), S536P-p65, and transcription factor EGR1 to interleukin-8 (IL-8) promoter, resulting in increased IL-8 production in ovarian cancer cells.
24297681 2014 Expression of early growth response-1 in colorectal cancer and its relation to tumor cell proliferation and apoptosis.
24190424 2014 Decreased c-Abl activity in PC-3 and LNCaP prostate cancer cells overexpressing the early growth response-1 protein.
24106272 2013 Early growth response-1 (EGR-1) and nuclear factor of activated T cells (NFAT) cooperate to mediate CD40L expression in megakaryocytes and platelets.
24098051 2013 Novel regulatory action of ribosomal inactivation on epithelial Nod2-linked proinflammatory signals in two convergent ATF3-associated pathways.
24077187 2013 Functional and pathway enrichment analysis for integrated regulatory network of high- and low-metastatic lung cancer.
24076422 2014 Stopped-flow fluorescence kinetic study of protein sliding and intersegment transfer in the target DNA search process.
24012056 2015 Association of Egr-1 and autophagy-related gene polymorphism in men with chronic obstructive pulmonary disease.
24011795 2013 Expression of early growth response-1 in human gastric cancer and its relationship with tumor cell behaviors and prognosis.
24001789 2013 ZnO nanoparticles induce TNF-? expression via ROS-ERK-Egr-1 pathway in human keratinocytes.
23945289 2013 Crucial role for early growth response-1 in the transcriptional regulation of miR-20b in breast cancer.
23874821 2013 Activation of Egr-1 in human lung epithelial cells exposed to silica through MAPKs signaling pathways.
23857582 2013 Heterogeneous nuclear ribonucleoprotein (HnRNP) K genome-wide binding survey reveals its role in regulating 3'-end RNA processing and transcription termination at the early growth response 1 (EGR1) gene through XRN2 exonuclease.
23802749 2013 Cloning and characterization of the GNA11 promoter and its regulation by early growth response 1.
23755764 Clinical significance of immunogenic cell death biomarker rage and early growth response 1 in human primary gastric adenocarcinoma.
23718776 2013 pH modulates the binding of early growth response protein 1 transcription factor to DNA.
23717422 2013 Apoptosis induction of human bladder cancer cells by sanguinarine through reactive oxygen species-mediated up-regulation of early growth response gene-1.
23715767 2013 Increased expression of p21Waf1/Cip1 and JNK with costimulation of prostate cancer cell activation by an siRNA Egr-1 inhibitor.
23696025 2013 PAK5-Egr1-MMP2 signaling controls the migration and invasion in breast cancer cell.
23632636 2013 Early growth response protein-1 mediates lipotoxicity-associated placental inflammation: role in maternal obesity.
23592216 2013 Suppression of the LMP2A target gene, EGR-1, protects Hodgkin's lymphoma cells from entry to the EBV lytic cycle.
23478574 2013 Egr-1 enhances drug resistance of breast cancer by modulating MDR1 expression in a GGPPS-independent manner.
23468057 2013 C-Reactive protein downregulates TRAIL expression in human peripheral monocytes via an Egr-1-dependent pathway.
23433111 2013 Egr-1 regulates the transcription of the BRCA1 gene by etoposide.
23416169 2013 NAB2 and EGR-1 exert opposite roles in regulating TRAIL expression in human Natural Killer cells.
23409769 2013 Early growth response gene-1 and hypoxia-inducible factor-1? affect tumor metastasis via regulation of tissue factor.
23373701 2013 Dopamine D2 receptor activation leads to an up-regulation of glial cell line-derived neurotrophic factor via G??-Erk1/2-dependent induction of Zif268.
23363221 2013 Epstein-Barr virus latent membrane protein 1 increases genomic instability through Egr-1-mediated up-regulation of activation-induced cytidine deaminase in B-cell lymphoma.
23178451 2013 Early growth response protein 1 upregulation and nuclear translocation by 2'-benzoyloxycinnamaldehyde induces prostate cancer cell death.
23152075 2013 Early growth response 1 regulates glucose deprivation-induced necrosis.
23142458 2013 Detection of neutralizing antibodies to erythropoietin by inhibition of rHuEPO-stimulated EGR1 gene expression in the UT-7/EPO cell line.
23127556 2012 HuR posttranscriptionally regulates early growth response-1 (Egr-1) expression at the early stage of T cell activation.
23121767 2013 EGR1 is critical for gastrin-dependent upregulation of anion exchanger 2 in gastric cancer cells.
23103837 2013 Cellular steatosis in ethanol oxidizing-HepG2 cells is partially controlled by the transcription factor, early growth response-1.
23029358 2012 MAML1 acts cooperatively with EGR1 to activate EGR1-regulated promoters: implications for nephrogenesis and the development of renal cancer.
22918686 2013 Egr-1 promotes cell proliferation and invasion by increasing ?-catenin expression in gastric cancer.
22912725 2012 Heparin inhibits Hepatocyte Growth Factor induced motility and invasion of hepatocellular carcinoma cells through early growth response protein 1.
22878149 2013 Ischemic postconditioning downregulates Egr-1 expression and attenuates postischemic pulmonary inflammatory cytokine release and tissue injury in rats.
22832523 2011 Transgenerational impact of intimate partner violence on methylation in the promoter of the glucocorticoid receptor.
22721276 2012 Real-imaging cDNA-AFLP transcript profiling of pancreatic cancer patients: Egr-1 as a potential key regulator of muscle cachexia.
22713211 FH535 potentiation of cigarette smoke condensate cytotoxicity is associated with changes in ?-catenin and EGR-1 signaling.
22659570 2012 LPA-induced suppression of periostin in human osteosarcoma cells is mediated by the LPA(1)/Egr-1 axis.
22634339 2012 Ambivalent roles of early growth response 1 in inflammatory signaling following ribosomal insult in human enterocytes.
22531302 2012 Molecular markers associated with nonepithelial ovarian cancer in formalin-fixed, paraffin-embedded specimens by genome wide expression profiling.
22508482 2013 Egr-1 mediates epidermal growth factor-induced downregulation of E-cadherin expression via Slug in human ovarian cancer cells.
22455954 2012 Egr-1 contributes to IL-1-mediated down-regulation of peroxisome proliferator-activated receptor ? expression in human osteoarthritic chondrocytes.
22433566 2012 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22431919 2012 Regulation of p130(Cas)/BCAR1 expression in tamoxifen-sensitive and tamoxifen-resistant breast cancer cells by EGR1 and NAB2.
22428032 2012 Resveratrol inhibits KSHV reactivation by lowering the levels of cellular EGR-1.
22354777 2013 Phosphorylation of histone H3 at serine 10 has an essential role in arsenite-induced expression of FOS, EGR1 and IL8 mRNA in cultured human cell lines.
22344601 2012 Intracoronary delivery of DNAzymes targeting human EGR-1 reduces infarct size following myocardial ischaemia reperfusion.
22316125 2012 EGFR ligands drive multipotential stromal cells to produce multiple growth factors and cytokines via early growth response-1.
22198386 2012 EGR1 and the ERK-ERF axis drive mammary cell migration in response to EGF.
22140445 2011 Xanthine oxidase-derived ROS upregulate Egr-1 via ERK1/2 in PA smooth muscle cells; model to test impact of extracellular ROS in chronic hypoxia.
22127986 2012 Early growth response 1 and fatty acid synthase expression is altered in tumor adjacent prostate tissue and indicates field cancerization.
22115966 2012 Induction of IGF-1R expression by EGR-1 facilitates the growth of prostate cancer cells.
22095683 2012 Upregulation of recepteur d'origine nantais tyrosine kinase and cell invasiveness via early growth response-1 in gastric cancer cells.
22053691 2011 Early growth response 1--a transcription factor in the crossfire of signal transduction cascades.
21998680 2011 Coordinated sumoylation and ubiquitination modulate EGF induced EGR1 expression and stability.
21995436 2011 Cigarette smoke-induced early growth response-1 regulates the expression of the cysteine-rich 61 in human skin dermal fibroblasts.
21968973 2012 Genes differentially regulated by NKX2-3 in B cells between ulcerative colitis and Crohn's disease patients and possible involvement of EGR1.
21931594 2011 Egr-1 induces a profibrotic injury/repair gene program associated with systemic sclerosis.
21791614 2011 p300-Dependent ATF5 acetylation is essential for Egr-1 gene activation and cell proliferation and survival.
21743958 2011 Inhibition of Egr-1 by siRNA in prostate carcinoma cell lines is associated with decreased expression of AP-1 and NF-?B.
21743491 2012 Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/?-catenin signaling axis.
21725089 2011 Diurnal regulation of the early growth response 1 (Egr-1) protein expression by hepatocyte nuclear factor 4alpha (HNF4alpha) and small heterodimer partner (SHP) cross-talk in liver fibrosis.
21688838 2011 An arginine residue instead of a conserved leucine residue in the recognition helix of the finger 3 of Zif268 stabilizes the domain structure and mediates DNA binding.
21617851 2011 Overexpression of EGR-1 modulates the activity of NF-?B and AP-1 in prostate carcinoma PC-3 and LNCaP cell lines.
21596316 2011 Two phases of mitogenic signaling unveil roles for p53 and EGR1 in elimination of inconsistent growth signals.
21551235 2011 Antiangiogenic antitumor activities of IGFBP-3 are mediated by IGF-independent suppression of Erk1/2 activation and Egr-1-mediated transcriptional events.
21506108 2011 Induction of Id-1 by FGF-2 involves activity of EGR-1 and sensitizes neuroblastoma cells to cell death.
21489990 2011 Early growth response 1 (Egr-1) regulates phosphorylation of microtubule-associated protein tau in mammalian brain.
21479245 2011 Serum response factor regulates immediate early host gene expression in Toxoplasma gondii-infected host cells.
21436631 2011 A gene signature distinguishing CD133hi from CD133- colorectal cancer cells: essential role for EGR1 and downstream factors.
21419860 2011 Nuclear import of early growth response-1 involves importin-7 and the novel nuclear localization signal serine-proline-serine.
21368226 2011 HIV-1 Tat-mediated induction of platelet-derived growth factor in astrocytes: role of early growth response gene 1.
21365018 2011 Expression of high-mobility groups box-1/receptor for advanced glycation end products/osteopontin/early growth response-1 pathway in proliferative vitreoretinal epiretinal membranes.
21354100 2011 Hypochlorite-modified high-density lipoprotein promotes induction of HO-1 in endothelial cells via activation of p42/44 MAPK and zinc finger transcription factor Egr-1.
21336263 2011 ERG gene rearrangements are common in prostatic small cell carcinomas.
21321112 2011 An early response transcription factor, Egr-1, enhances insulin resistance in type 2 diabetes with chronic hyperinsulinism.
21297666 2011 E-cadherin inhibits tumor cell growth by suppressing PI3K/Akt signaling via ?-catenin-Egr1-mediated PTEN expression.
21224049 2011 Cigarette smoke-induced pulmonary inflammatory responses are mediated by EGR-1/GGPPS/MAPK signaling.
21212994 2013 TNF-? induces early growth response gene-1 expression via ERK1/2 activation in endothelial cells.
21189327 2011 MicroRNAs miR-199a-5p and -3p target the Brm subunit of SWI/SNF to generate a double-negative feedback loop in a variety of human cancers.
21160498 2011 Functional characterization of SAMD9, a protein deficient in normophosphatemic familial tumoral calcinosis.
21118966 2010 MicroRNA miR-183 functions as an oncogene by targeting the transcription factor EGR1 and promoting tumor cell migration.
20945384 2011 CXCL5/ENA78 increased cell migration and epithelial-to-mesenchymal transition of hormone-independent prostate cancer by early growth response-1/snail signaling pathway.
20864524 2010 Cell membrane-bound Kaposi's sarcoma-associated herpesvirus-encoded glycoprotein B promotes virus latency by regulating expression of cellular Egr-1.
20811575 2010 Global Egr1-miRNAs binding analysis in PMA-induced K562 cells using ChIP-Seq.
20690147 2010 Global analysis of in vivo EGR1-binding sites in erythroleukemia cell using chromatin immunoprecipitation and massively parallel sequencing.
20621662 2010 Cigarette smoke-induced Egr-1 represses T beta R-II expression in human skin dermal fibroblasts.
20585888 2010 ZNF300, a recently identified human transcription factor, activates the human IL-2R? promoter through the overlapping ZNF300/EGR1 binding site.
20507991 2010 Advanced glycation end product (AGE)-receptor for AGE (RAGE) signaling and up-regulation of Egr-1 in hypoxic macrophages.
20506119 2010 EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.
20489156 2010 Early growth response-1 induces and enhances vascular endothelial growth factor-A expression in lung cancer cells.
20448047 2010 Placenta growth factor-induced early growth response 1 (Egr-1) regulates hypoxia-inducible factor-1alpha (HIF-1alpha) in endothelial cells.
20414733 2011 Activation of Egr-1 expression in astrocytes by HIV-1 Tat: new insights into astrocyte-mediated Tat neurotoxicity.
20403028 2010 Abnormal expression of early growth response 1 in gastric cancer: association with tumor invasion, metastasis and heparanase transcription.
20372793 2010 The role of thymidine phosphorylase in the induction of early growth response protein-1 and thrombospondin-1 by 5-fluorouracil in human cancer carcinoma cells.
20363028 2010 Mature human neutrophils constitutively express the transcription factor EGR-1.
20348948 2010 T-box 2 represses NDRG1 through an EGR1-dependent mechanism to drive the proliferation of breast cancer cells.
20204305 2010 The effect of siRNA-Egr-1 and camptothecin on growth and chemosensitivity of breast cancer cell lines.
20190820 2010 Mutant p53 initiates a feedback loop that involves Egr-1/EGF receptor/ERK in prostate cancer cells.
20144677 2010 No association between EGR gene family polymorphisms and schizophrenia in the Chinese population.
20121949 2010 Snail associates with EGR-1 and SP-1 to upregulate transcriptional activation of p15INK4b.
20087343 2010 Early growth response-1 is a regulator of DR5-induced apoptosis in colon cancer cells.
20053757 2010 15(S)-hydroxyeicosatetraenoic acid-induced angiogenesis requires Src-mediated Egr-1-dependent rapid induction of FGF-2 expression.
20018936 2010 Phosphorylation and acetylation of histone H3 and autoregulation by early growth response 1 mediate interleukin 1beta induction of early growth response 1 transcription.
20016208 2010 Porphyromonas gingivalis antigens and interleukin-6 stimulate the production of monocyte chemoattractant protein-1 via the upregulation of early growth response-1 transcription in human coronary artery endothelial cells.
20009530 2009 Early growth response 1 (EGR1): a gene with as many names as biological functions.
19940138 2010 c-Jun regulates shear- and injury-inducible Egr-1 expression, vein graft stenosis after autologous end-to-side transplantation in rabbits, and intimal hyperplasia in human saphenous veins.
19915002 2010 Early growth response protein-1 (Egr-1) is preferentially expressed in T helper type 2 (Th2) cells and is involved in acute transcription of the Th2 cytokine interleukin-4.
19913601 2010 Transcriptional activation of the human Klotho gene by epidermal growth factor in HEK293 cells; role of Egr-1.
19888474 2009 The transcriptional cofactor nab2 is induced by tgf-Beta and suppresses fibroblast activation: physiological roles and impaired expression in scleroderma.
19885607 2009 Down-regulation of Egr-1 by siRNA inhibits growth of human prostate carcinoma cell line PC-3.
19878561 2009 High frequency of tumor cells with nuclear Egr-1 protein expression in human bladder cancer is associated with disease progression.
19837979 2010 Identification of early growth response protein 1 (EGR-1) as a novel target for JUN-induced apoptosis in multiple myeloma.
19837667 2009 Targeted knockdown of EGR-1 inhibits IL-8 production and IL-8-mediated invasion of prostate cancer cells through suppressing EGR-1/NF-kappaB synergy.
19833116 2010 High-level expression of early growth response-1 and association of polymorphism with total IgE and atopy in allergic rhinitis adults.
19822898 2009 Differential roles for ETS, CREB, and EGR binding sites in mediating VEGF receptor 1 expression in vivo.
19786090 2010 Downregulation of stathmin expression is mediated directly by Egr1 and associated with p53 activity in lung cancer cell line A549.
19781349 2009 [Study of the relationship between early growth response gene 1 activity in p38 mitogen-activated protein kinase pathway and epirubicin resistance of human breast carcinoma cells].
19765320 2009 Transcriptional control of Flt3 ligand targeted by fluorouracil-induced Egr-1 promoter in hematopoietic damage.
19747485 2009 Regulated expression of the alpha isoform of the human thromboxane A2 receptor during megakaryocyte differentiation: a coordinated role for WT1, Egr1, and Sp1.
19724854 2009 Enhanced radiosensitivity of SW480 cells via TRAIL up-regulation mediated by Egr-1 promoter.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19526316 2009 Hepatocyte growth factor induced up-regulations of VEGF through Egr-1 in hepatocellular carcinoma cells.
19467232 2009 Early growth response 1 loops the CYP2B6 promoter for synergistic activation by the distal and proximal nuclear receptors CAR and HNF4alpha.
19446747 2009 Cryptic deletion of EGR1 in association with a novel balanced t(5;22)(q31;q11.2) in a patient with myelodysplastic syndrome.
19435811 2009 A key role for early growth response-1 and nuclear factor-kappaB in mediating and maintaining GRO/CXCR2 proliferative signaling in esophageal cancer.
19432968 2009 Thrombin induces Egr-1 expression in fibroblasts involving elevation of the intracellular Ca2+ concentration, phosphorylation of ERK and activation of ternary complex factor.
19426596 2009 [Effects of fluorouracil-induced Flt3 Ligand gene expression transcriptional regulated by Egr-1 promoter sequences].
19374776 2009 Genome-wide investigation of in vivo EGR-1 binding sites in monocytic differentiation.
19307576 2009 Posttranscriptional regulation of interleukin-10 expression by hsa-miR-106a.
19307156 2009 T-bet expression is regulated by EGR1-mediated signaling in activated T cells.
19276347 2009 E2F1 Induces tumor cell survival via nuclear factor-kappaB-dependent induction of EGR1 transcription in prostate cancer cells.
19261809 2009 Transforming growth factor beta1-mediated activation of the smooth muscle alpha-actin gene in human pulmonary myofibroblasts is inhibited by tumor necrosis factor-alpha via mitogen-activated protein kinase kinase 1-dependent induction of the Egr-1 transcriptional repressor.
19245972 2009 Early growth response factor-1 is associated with intraluminal thrombus formation in human abdominal aortic aneurysm.
19152168 2009 Thalidomide inhibits leukemia cell invasion and migration by upregulation of early growth response gene 1.
19131339 2009 Oxidative stress promotes transcriptional up-regulation of Fyn in BCR-ABL1-expressing cells.
19115247 2009 HDAC4 contributes to IL-1-induced mPGES-1 expression in human synovial fibroblasts through up-regulation of Egr-1 transcriptional activity.
19112164 2009 Early growth response-1 regulates angiopoietin-1-induced endothelial cell proliferation, migration, and differentiation.
19074849 2008 ESE-1/EGR-1 pathway plays a role in tolfenamic acid-induced apoptosis in colorectal cancer cells.
19074480 2009 Increased expression of the transforming growth factor-beta signaling pathway, endoglin, and early growth response-1 in stable plaques.
19057511 2009 PTEN regulation by Akt-EGR1-ARF-PTEN axis.
19032775 2008 Egr1 regulates the coordinated expression of numerous EGF receptor target genes as identified by ChIP-on-chip.
18989526 2008 Phorbol 12-myristate 13-acetate (PMA) responsive sequence in Galphaq promoter during megakaryocytic differentiation. Regulation by EGR-1 and MAP kinase pathway.
18842581 2008 Cyclooxygenase-2-derived prostaglandin E2 stimulates Id-1 transcription.
18830406 2008 Egr-1 regulates autophagy in cigarette smoke-induced chronic obstructive pulmonary disease.
18780286 2008 Egr-1 and serum response factor are involved in growth factors- and serum-mediated induction of E2-EPF UCP expression that regulates the VHL-HIF pathway.
18772333 2008 Smad-independent transforming growth factor-beta regulation of early growth response-1 and sustained expression in fibrosis: implications for scleroderma.
18718911 2008 Epigenetic regulation of HYAL-1 hyaluronidase expression. identification of HYAL-1 promoter.
18711316 2008 Cl- -channel is essential for LDL-induced cell proliferation via the activation of Erk1/2 and PI3k/Akt and the upregulation of Egr-1 in human aortic smooth muscle cells.
18704310 2008 Targeting of p38 mitogen-activated protein kinases to early growth response gene 1 (EGR-1) in the human paclitaxel-resistance ovarian carcinoma cells.
18682391 2008 Histamine induces Egr-1 expression in human aortic endothelial cells via the H1 receptor-mediated protein kinase Cdelta-dependent ERK activation pathway.
18675783 2008 Regulatory mechanism of TNFalpha autoregulation in HaCaT cells: the role of the transcription factor EGR-1.
18636116 2008 Evaluation of EGR1 as a candidate gene for high myopia.
18604866 2008 Transcription of PRDM1, the master regulator for plasma cell differentiation, depends on an SP1/SP3/EGR-1 GC-box.
18583706 2008 Stimulation of the human CTP:phosphoethanolamine cytidylyltransferase gene by early growth response protein 1.
18525291 The Sp1/Egr1-tandem repeat polymorphism in the 5-lipoxygenase gene promoter is not associated with late onset Alzheimer disease.
18515748 2008 Aryl hydrocarbon receptor is activated by glucose and regulates the thrombospondin-1 gene promoter in endothelial cells.
18507785 2009 Association of early growth response-1 gene polymorphisms with total IgE and atopy in asthmatic children.
18489490 2009 EGR-1 is regulated by N-methyl-D-aspartate-receptor stimulation and associated with patient survival in human high grade astrocytomas.
18469860 2008 Activation of BAG3 by Egr-1 in response to FGF-2 in neuroblastoma cells.
18460021 2008 Early growth response-1 mediates downregulation of telomerase in cervical cancer.
18435749 2008 Gene expression analysis in absence epilepsy using a monozygotic twin design.
18434089 2008 Extracellular ATP activates the PLC/PKC/ERK signaling pathway through the P2Y2 purinergic receptor leading to the induction of early growth response 1 expression and the inhibition of viability in human endometrial stromal cells.
18434015 2008 Wildtype Elk-1, but not a SUMOylation mutant, represses egr-1 expression in SH-SY5Y neuroblastomas.
18324520 2008 APE1/Ref-1 regulates PTEN expression mediated by Egr-1.
18316600 2008 p21 Waf1/Cip1 expression by curcumin in U-87MG human glioma cells: role of early growth response-1 expression.
18303024 2008 Nuclear receptor CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene.
18281687 2008 Transcriptional regulation of EGR-1 by the interleukin-1-JNK-MKK7-c-Jun pathway.
18247371 2008 HIV-1 Tat inhibits NGF-induced Egr-1 transcriptional activity and consequent p35 expression in neural cells.
18215136 2008 Involvement of Egr-1 in HGF-induced elevation of the human 5alpha-R1 gene in human hepatocellular carcinoma cells.
18204200 Concurrent down-regulation of Egr-1 and gelsolin in the majority of human breast cancer cells.
18174470 2008 Heme Egr-1: new partners in atherosclerotic progression?
18171299 2008 Microarray analysis of a Chlamydia pneumoniae-infected human epithelial cell line by use of gene ontology hierarchy.
18088351 2008 Antithrombin inhibits lipopolysaccharide-induced tumor necrosis factor-alpha production by monocytes in vitro through inhibition of Egr-1 expression.
18068676 2008 Reciprocal regulation of the human sterol regulatory element binding protein (SREBP)-1a promoter by Sp1 and EGR-1 transcription factors.
18067864 2007 Phorbol myristate acetate-induced Egr-1 expression is suppressed by phospholipase D isozymes in human glioma cells.
18027854 2008 Transcriptional regulation of human survivin by early growth response (Egr)-1 transcription factor.
17986608 2007 PAX3-FOXO1 controls expression of the p57Kip2 cell-cycle regulator through degradation of EGR1.
17975260 2007 Early growth response gene-1 plays a pivotal role in down-regulation of a cohort of genes in uterine leiomyoma.
17967787 2008 Hemin upregulates Egr-1 expression in vascular smooth muscle cells via reactive oxygen species ERK-1/2-Elk-1 and NF-kappaB.
17932312 2007 Activated protein C decreases tumor necrosis factor related apoptosis-inducing ligand by an EPCR- independent mechanism involving Egr-1/Erk-1/2 activation.
17671831 2008 Calcipotriol affects keratinocyte proliferation by decreasing expression of early growth response-1 and polo-like kinase-2.
17631291 2007 The EP4 receptor antagonist, L-161,982, blocks prostaglandin E2-induced signal transduction and cell proliferation in HCA-7 colon cancer cells.
17631285 2007 Interleukin-1 beta-induced Id2 gene expression is mediated by Egr-1 in vascular smooth muscle cells.
17599039 2008 Egr-1 abrogates the E2F-1 block in terminal myeloid differentiation and suppresses leukemia.
17581316 2007 Induction of urokinase-type plasminogen activator, interleukin-8 and early growth response-1 by STI571 through activating mitogen activated protein kinase in human small cell lung cancer cells.
17559061 2007 Radiofrequency radiation (900 MHz) induces Egr-1 gene expression and affects cell-cycle control in human neuroblastoma cells.
17516844 2007 Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway.
17502875 2007 Early growth response gene 1 (Egr-1) regulates HSV-1 ICP4 and ICP22 gene expression.
17494953 2007 MAPK pathway mediates EGR-1-HSP70-dependent cigarette smoke-induced chemokine production.
17448597 2008 Marked gene transcript level alterations occur early during radical prostatectomy.
17420284 2007 Haploinsufficiency of EGR1, a candidate gene in the del(5q), leads to the development of myeloid disorders.
17257596 2007 Egr-1, a new downstream molecule of Epstein-Barr virus latent membrane protein 1.
17099140 2007 Cigarette smoke stimulates matrix metalloproteinase-2 activity via EGR-1 in human lung fibroblasts.
16995904 2006 Early growth response transcription factor EGR-1 regulates Galphaq gene in megakaryocytic cells.
16858414 2006 Hepatocyte growth factor induces cell scattering through MAPK/Egr-1-mediated upregulation of Snail.
16831524 2006 The transcription factor Egr-1 is a regulator of the human TopBP1 gene.
16741963 2006 Dysregulation of NGF-signaling and Egr-1 expression by Tat in neuronal cell culture.
16702209 2006 The early-immediate gene EGR-1 is induced by transforming growth factor-beta and mediates stimulation of collagen gene expression.
16552541 2006 Expression of genes involved in the regulation of p16 in psoriatic involved skin.
16464174 2006 Transcriptional stimulation of the human NHE3 promoter activity by PMA: PKC independence and involvement of the transcription factor EGR-1.
16393964 2006 Early growth response-1 is required for CD154 transcription.
16382041 2005 Mechanisms of prostate tumorigenesis: roles for transcription factors Nkx3.1 and Egr1.
16260776 2005 Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter thereby establishing a negative feedback loop.
16093249 2005 Early growth response gene 1 (EGR1) regulates heparanase gene transcription in tumor cells.
16091742 2005 c-Abl regulates early growth response protein (EGR1) in response to oxidative stress.
16079301 2005 Transcriptional regulation of activating transcription factor 3 involves the early growth response-1 gene.
16007175 2005 Promoter CpG hypomethylation and transcription factor EGR1 hyperactivate heparanase expression in bladder cancer.
15999367 2005 Early growth response gene 1 (EGR1) is deleted in estrogen receptor-negative human breast carcinoma.
15923644 2005 Differential involvement of calmodulin-dependent protein kinase II-activated AP-1 and c-Jun N-terminal kinase-activated EGR-1 signaling pathways in tumor necrosis factor-alpha and lipopolysaccharide-induced CD44 expression in human monocytic cells.
15910736 2005 Transcriptional activation of the Egr-1 gene mediated by tetradecanoylphorbol acetate and extracellular signal-regulated protein kinase.
15875316 2005 Fibroblast growth factor 2 and the transcription factor Egr-1 localise to endothelial cell microvascular channels in human coronary artery occlusion.
15709168 2005 Increased heparanase expression is caused by promoter hypomethylation and up-regulation of transcriptional factor early growth response-1 in human prostate cancer.
15689620 2005 Delayed activation of insulin-like growth factor-1 receptor/Src/MAPK/Egr-1 signaling regulates clusterin expression, a pro-survival factor.
15640148 2005 Early growth response factor-1 mediates prostaglandin E2-dependent transcriptional suppression of cytokine-induced tumor necrosis factor-alpha gene expression in human macrophages and rheumatoid arthritis-affected synovial fibroblasts.
15611055 2005 Essential interaction of Egr-1 at an islet-specific response element for basal and gastrin-dependent glucagon gene transactivation in pancreatic alpha-cells.
15548700 2004 Transactivation of the EGR1 gene contributes to mutant p53 gain of function.
15545275 2005 Early growth response-1 regulates lipopolysaccharide-induced suppressor of cytokine signaling-1 transcription.
15523672 2005 Specificity of transcriptional regulation by the zinc finger transcription factors Sp1, Sp3, and Egr-1.
15517593 2005 PTEN expression elicited by EGR-1 transcription factor in calyculin A-induced apoptotic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486985 2005 Regulation of expression of the early growth response gene-1 (EGR-1) in malignant and benign cells of the prostate.
15449318 2004 Egr-1 is activated by 17beta-estradiol in MCF-7 cells by mitogen-activated protein kinase-dependent phosphorylation of ELK-1.
15231681 2004 Decreased expression of early growth response-1 and its role in uterine leiomyoma growth.
15225550 2004 Coactivating factors p300 and CBP are transcriptionally crossregulated by Egr1 in prostate cells, leading to divergent responses.
15211096 2004 Egr-1 is a major vascular pathogenic transcription factor in atherosclerosis and restenosis.
15155664 2004 Helicobacter pylori activates the early growth response 1 protein in gastric epithelial cells.
15023995 2004 Activation of peroxisome proliferator-activated receptor gamma inhibits interleukin-1beta-induced membrane-associated prostaglandin E2 synthase-1 expression in human synovial fibroblasts by interfering with Egr-1.
15003938 2004 Induction of early growth-response factor 1 by platelet-derived growth factor in human airway smooth muscle.
14985468 2004 The cytoskeleton differentially localizes the early growth response gene-1 protein in cancer and benign cells of the prostate.
14979875 2004 Co-operative interactions between NFAT (nuclear factor of activated T cells) c1 and the zinc finger transcription factors Sp1/Sp3 and Egr-1 regulate MT1-MMP (membrane type 1 matrix metalloproteinase) transcription by glomerular mesangial cells.
14966901 2004 Expression of Egr-1, c-fos and cyclin D1 in esophageal cancer and its precursors: An immunohistochemical and in situ hybridization study.
14744935 2004 Endoplasmic reticulum stress induces p53 cytoplasmic localization and prevents p53-dependent apoptosis by a pathway involving glycogen synthase kinase-3beta.
14722058 2004 Microsomal prostaglandin E synthase-1 is overexpressed in inflammatory bowel disease. Evidence for involvement of the transcription factor Egr-1.
14662774 2004 Expression of NAG-1, a transforming growth factor-beta superfamily member, by troglitazone requires the early growth response gene EGR-1.
14522979 2003 Regulation of inducible heparanase gene transcription in activated T cells by early growth response 1.
12958075 2004 Jun N-terminal kinase activity and early growth-response factor-1 gene expression are down-regulated in Fanconi anemia group A lymphoblasts.
12947119 2003 Specific interaction of Egr1 and c/EBPbeta leads to the transcriptional activation of the human low density lipoprotein receptor gene.
12890669 2003 Early growth response gene 1 modulates androgen receptor signaling in prostate carcinoma cells.
12872165 2003 Transcription factor Egr-1 supports FGF-dependent angiogenesis during neovascularization and tumor growth.
12729460 2003 Extracellular ATP stimulates the early growth response protein 1 (Egr-1) via a protein kinase C-dependent pathway in the human osteoblastic HOBIT cell line.
12706485 2003 The egr-1 gene is induced by DNA-damaging agents and non-genotoxic drugs in both normal and neoplastic human cells.
12690110 2003 p21Cip1 gene expression is modulated by Egr1: a novel regulatory mechanism involved in the resveratrol antiproliferative effect.
12637574 2003 Egr-1 mediates transcriptional repression of COL2A1 promoter activity by interleukin-1beta.
12618431 2003 ERK and p38 inhibit the expression of 4E-BP1 repressor of translation through induction of Egr-1.
12571843 2003 Transcription factor early growth response 1 activity up-regulates expression of tissue inhibitor of metalloproteinases 1 in human synovial fibroblasts.
12569082 2003 Suppression of HGF receptor gene expression by oxidative stress is mediated through the interplay between Sp1 and Egr-1.
12566441 2003 Prostaglandin E2 induced functional expression of early growth response factor-1 by EP4, but not EP2, prostanoid receptors via the phosphatidylinositol 3-kinase and extracellular signal-regulated kinases.
12560508 2003 Reciprocal regulation of expression of the human adenosine 5'-triphosphate binding cassette, sub-family A, transporter 2 (ABCA2) promoter by the early growth response-1 (EGR-1) and Sp-family transcription factors.
12560487 2003 Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
12553721 2002 Transcription factor Egr-1 activates collagen expression in immortalized fibroblasts or fibrosarcoma cells.
12553019 Overexpression of early growth response-1 as a metastasis-regulatory factor in gastric cancer.
12543866 2003 Regulation of tissue factor and inflammatory mediators by Egr-1 in a mouse endotoxemia model.
12517959 2003 Up-regulation of early growth response gene-1 via the CXCR3 receptor induces reactive oxygen species and inhibits Na+/K+-ATPase activity in an immortalized human proximal tubule cell line.
12507899 2003 Role of INK4a/Arf locus-encoded senescent checkpoints activated in normal and psoriatic keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470865 2002 Basal EGR-1 (zif268, NGFI-A, Krox-24) expression in developing striatal patches: role of dopamine and glutamate.
12457461 2003 Early stimulation and late inhibition of peroxisome proliferator-activated receptor gamma (PPAR gamma) gene expression by transforming growth factor beta in human aortic smooth muscle cells: role of early growth-response factor-1 (Egr-1), activator protein 1 (AP1) and Smads.
12456801 2002 Interaction of early growth response protein 1 (Egr-1), specificity protein 1 (Sp1), and cyclic adenosine 3'5'-monophosphate response element binding protein (CREB) at a proximal response element is critical for gastrin-dependent activation of the chromogranin A promoter.
12439908 2002 Relationship between Egr-1 gene expression and apoptosis in esophageal carcinoma and precancerous lesions.
12433834 2002 Phorbol ester induction of angiotensin-converting enzyme transcription is mediated by Egr-1 and AP-1 in human endothelial cells via ERK1/2 pathway.
12393577 2002 The proximal serum response element in the Egr-1 promoter mediates response to thrombin in primary human endothelial cells.
12384223 2002 Substance P induced biosynthesis of the zinc finger transcription factor Egr-1 in human glioma cells requires activation of the epidermal growth factor receptor and of extracellular signal-regulated protein kinase.
12379479 2002 Regulation of Egr-1 by association with the proteasome component C8.
12235180 2002 Identification of Egr1 as the oncostatin M-induced transcription activator that binds to sterol-independent regulatory element of human LDL receptor promoter.
12165491 2002 Thymocyte development in early growth response gene 1-deficient mice.
12065847 Egr1 transcription factor: multiple roles in prostate tumor cell growth and survival.
12011097 2002 Early growth response factor-1 is a critical transcriptional mediator of peroxisome proliferator-activated receptor-gamma 1 gene expression in human aortic smooth muscle cells.
11978801 2002 Induction of tissue factor expression in human endothelial cells by CD40 ligand is mediated via activator protein 1, nuclear factor kappa B, and Egr-1.
11956220 2002 Activation of human monoamine oxidase B gene expression by a protein kinase C MAPK signal transduction pathway involves c-Jun and Egr-1.
11925592 2002 Transcription factor EGR-1 inhibits growth of hepatocellular carcinoma and esophageal carcinoma cell lines.
11909874 2002 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter.
11795984 2002 Dedifferentiation-associated changes in morphology and gene expression in primary human articular chondrocytes in cell culture.
11278640 2001 Identification of amino acid residues in the ETS transcription factor Erg that mediate Erg-Jun/Fos-DNA ternary complex formation.
11251186 2001 Physical interaction between p53 and primary response gene Egr-1.
11124866 2000 The nuclear, 75 kDa form of early growth response protein-1/nerve growth factor-induced A protein is primarily restricted to LH beta-subunit-expressing cells in rat anterior pituitary.
10849212 2000 Cyclical expression of egr-1/NGFI-A in the rat anterior pituitary: a molecular signal for ovulation?
10806043 2000 Differential expression of egr-1 in osteoarthritic compared to normal adult human articular cartilage.
10671503 2000 Inhibition of the RelA(p65) NF-kappaB subunit by Egr-1.
10575214 1999 High resolution physical mapping of human HDAC3, a potential tumor suppressor gene in the 5q31 region.
10409428 1999 Gene expression in proliferating human erythroid cells.
10082522 1999 Egr-1 is a downstream effector of GnRH and synergizes by direct interaction with Ptx1 and SF-1 to enhance luteinizing hormone beta gene transcription.
10079243 1999 Pathways of Egr-1-mediated gene transcription in vascular biology.
10051405 1999 Genomic organization and chromosomal localization of the human histone deacetylase 3 gene.
10049687 1999 Regulation of Egr-1-dependent gene expression by the C-terminal activation domain.
9806899 1998 cAMP-response-element-binding-protein-binding protein (CBP) and p300 are transcriptional co-activators of early growth response factor-1 (Egr-1).
8668170 1996 NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.
8662759 1996 Casein kinase II associates with Egr-1 and acts as a negative modulator of its DNA binding and transcription activities in NIH 3T3 cells.
7624335 1995 Identification of NAB1, a repressor of NGFI-A- and Krox20-mediated transcription.
3839394 1985 cDNA cloning of mRNAS which increase rapidly in human lymphocytes cultured with concanavalin-A and cycloheximide.
3127059 1988 A zinc finger-encoding gene coregulated with c-fos during growth and differentiation, and after cellular depolarization.
2377485 1990 cDNA sequence of the human cellular early growth response gene Egr-1.
2110381 1990 Expression of a zinc finger gene in HTLV-I- and HTLV-II-transformed cells.
2109185 1990 Identification and characterization of the Egr-1 gene product, a DNA-binding zinc finger protein induced by differentiation and growth signals.
1702972 1990 A set of human putative lymphocyte G0/G1 switch genes includes genes homologous to rodent cytokine and zinc finger protein-encoding genes.
1662794 1991 Characterization of the zinc finger protein encoded by the WT1 Wilms' tumor locus.
1569051 1992 A gene coding for a zinc finger protein is induced during 12-O-tetradecanoylphorbol-13-acetate-stimulated HL-60 cell differentiation.
1411083 1992 Spontaneous expression of immediately-early response genes c-fos and egr-1 in collagenase-producing rheumatoid synovial fibroblasts.
1383501 1992 Expression of collagenase and potential transcriptional factors c-fos and egr-1 in periodontal gingival fibroblasts.
1090709 1975 Brain function and behavior. I. Emotion and sensory phenomena in psychotic patients and in experimental animals.