Property Summary

Ligand Count 70
NCBI Gene PubMed Count 77
PubMed Score 0.00
PubTator Score 66.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
TOBACCO ADDICTION, SUSCEPTIBILITY TO 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

 GO Component (2)

Gene RIF (47)

AA Sequence

MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS      1 - 70
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE     71 - 140
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV    141 - 210
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT    211 - 280
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF    281 - 350
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT                 351 - 407
//

Text Mined References (82)

PMID Year Title