Property Summary

NCBI Gene PubMed Count 47
PubMed Score 65.02
PubTator Score 59.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.400 2.9e-05
medulloblastoma, large-cell -1.400 4.4e-05
non-small cell lung cancer -1.551 9.1e-18
breast carcinoma -1.100 1.6e-03
adult high grade glioma -1.200 2.7e-04
posterior fossa group B ependymoma -1.100 4.2e-08
lung adenocarcinoma -1.200 7.4e-05

Gene RIF (37)

PMID Text
26542361 The preferential expression of EGFL7 in less differentiated hepatocellular carcinoma compared to VEGF, suggests a possible important role of this angiogenic factor in a later oncogenic and infiltrative/metastatic phase.
26504055 Loss of EGFL7 expression is associated with Malignant Pleural Mesothelioma.
26288231 EGFR mutational analysis is useful in the diagnosis of non-small-cell-lung cancer.
25987088 High EGFL7 expression promotes migration and Epithelial-Mesenchymal Transition in pancreatic Cancer.
25730089 EGFL7, OPN, and PGE2 may have a role in recurrence and metastasis of hepatocellular carcinoma
25667199 Data suggest that, in trophoblast cells, EGFL7 regulates cell migration and invasion/placentation by activating multiple signaling pathways via MAPK, PI3K (phosphatidylinositol 3-kinase), and NOTCH1 (translocation-associated notch protein 1).
25601205 Endothelial cells control pancreatic cell fate at defined stages through EGFL7 signaling.
25592646 The aim of the present descriptive study was to analyse the intra-tumoural expressions of epidermal growth factor-like domain 7 (EGFL7) and microRNA-126 (miRNA-126) in primary tumours from patients with stage II-IV colorectal cancer.
25140000 EGFL7 may predict response to first-line chemotherapy and bevacizumab in patients with metastatic colorectal cancer
24945379 EGFL7 enhances EGFR-AKT signaling, epithelial-mesenchymal transition, and metastasis of gastric cancer cells.
24815445 EGFL7 promotes growth of Renal cell carcinoma by facilitating migration and tube formation of endothelial cells. These effects were produced by EGFL7-mediated focal adhesion kinase phosphorylation through combination with epidermal growth factor receptor.
24751645 demonstrate significantly reduced Egfl7 expression in pre-eclampsia placentas, concurrent with a downregulation of Notch target genes
24696719 malignant glioma cells and glioma vascular endothelial cells highly express VE-statin/Egfl7, which is significantly correlated with the degree of malignancy.
24595089 egfl7 is initially expressed in all endothelial cells and then is progressively restricted to veins and to their neighbouring capillaries.
24286167 The loss of EGFL7 expression play a role in the development and progression of systemic sclerosis.
23922111 study provides clinical data indicating a relationship between miRNA-126 and the clinical outcome of metastatic colorectal cancer patients treated with chemotherapy combined with anti-VEGF-A, whereas the impact of EGFL7 is more speculative
23558933 Egfl7 is significantly upregulated in human epithelial tumor tissues, suggesting Egfl7 to be a potential biomarker for human epithelial tumors, especially liver and breast cancer.
23404186 Egfl7 expression is thus associated with better prognosis factors and with the absence of lymph node invasion in human breast cancer lesions.
23386126 Data indicate that EGFL7 and integrin alphavbeta3 integrin colocalized in vesicular structures in uman umbilical vein endothelial cells (HUVECs).
23280513 Early-onset intrauterine growth restriction at 20-24 weeks' gestation is associated with higher values of EGFL7 expression in maternal plasma.
22160377 Studies indicate that Egfl7 controls blood vessel development by promoting endothelial cell migration and proliferation.
22037871 Human breast cancer lesions expressing high levels of Egfl7.
22018271 Heterogeneous methylation in the promoter region of EGFL7 was associated with cancer progression in non-small cell lung cancer.
22013081 Two angiogenesis-associated transcripts (Egfl7 and Acvrl1) showed lower expression in early-onset PE versus late-onset pre-eclampsia and versus gestational age-matched controls.
20953557 Studies indicate that two biologically active miRNAs miR-126 and its complement miR-126*, which are encoded by intron 7 of the egfl7 gene, have been described to mediate vascular functions.
20837907 Epidermal growth factor-like domain 7 suppresses intercellular adhesion molecule 1 expression in response to hypoxia/reoxygenation injury in human coronary artery endothelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20423846 miR-126 can downregulate EGFL7 expression at the protein level in ECV-304 cells.
20213100 EGFL7 may be used as a predictive marker for glioma prognosis and as a potential therapeutic target for malignant glioma.
20034472 miR-126 can inhibit proliferation of non-small cell lung cancer cells through one of its targets, EGFL7.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19824075 Egfl7 promotes metastasis of hepatocellular carcinoma (HCC) by enhancing cell motility through EGFR-dependent FAK phosphorylation.
19116145 Mature miR-126 can be generated from three different transcripts of EGFL7 with each one having its own promoter.
18521848 The lack of association between expression of miRNA and its host gene EGFL7 suggests their regulation by independent stimuli in colon cancer.
18193184 Intronic miRNAs from tissue-specific transcripts, or their natural absence, make cardinal contributions to cellular gene expression and phenotype.
17934064 Human EGFL7 may protect endothelial cell from hyperoxia-induced apoptosis by inhibition of mitochondria-dependent apoptosis pathway.
14592969 is the first identified inhibitor of mural cell migration specifically produced by endothelial cells.

AA Sequence

MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR      1 - 70
TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE     71 - 140
CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL    141 - 210
EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS           211 - 273
//

Text Mined References (49)

PMID Year Title
26542361 2016 Different expression of VEGF and EGFL7 in human hepatocellular carcinoma.
26504055 2015 Methylation-associated Silencing of microRNA-126 and its Host Gene EGFL7 in Malignant Pleural Mesothelioma.
26288231 2015 Preanalytic parameters in epidermal growth factor receptor mutation testing for non-small cell lung carcinoma: A review of cytologic series.
25987088 2015 Suppression of the Epidermal Growth Factor-like Domain 7 and Inhibition of Migration and Epithelial-Mesenchymal Transition in Human Pancreatic Cancer PANC-1 Cells.
25730089 2015 Multivariate analysis of molecular markers in peripheral blood associated with recurrence and metastasis of hepatocellular carcinoma.
25667199 2015 Epidermal growth factor-like domain 7 promotes migration and invasion of human trophoblast cells through activation of MAPK, PI3K and NOTCH signaling pathways.
25601205 2015 Endothelial cells control pancreatic cell fate at defined stages through EGFL7 signaling.
25592646 2015 Intra-tumoural vessel area estimated by expression of epidermal growth factor-like domain 7 and microRNA-126 in primary tumours and metastases of patients with colorectal cancer: a descriptive study.
25140000 2014 Epidermal growth factor-like domain 7 predicts response to first-line chemotherapy and bevacizumab in patients with metastatic colorectal cancer.
24945379 2014 Epidermal growth factor-like domain-containing protein 7 (EGFL7) enhances EGF receptor-AKT signaling, epithelial-mesenchymal transition, and metastasis of gastric cancer cells.
24815445 2014 Targeting EGFL7 expression through RNA interference suppresses renal cell carcinoma growth by inhibiting angiogenesis.
24751645 2014 Novel expression of EGFL7 in placental trophoblast and endothelial cells and its implication in preeclampsia.
24696719 2014 VE-statin/Egfl7 expression in malignant glioma and its relevant molecular network.
24595089 2014 Egfl7 is differentially expressed in arteries and veins during retinal vascular development.
24286167 2013 Decreased expression of the endothelial cell-derived factor EGFL7 in systemic sclerosis: potential contribution to impaired angiogenesis and vasculogenesis.
23922111 2013 MicroRNA-126 and epidermal growth factor-like domain 7-an angiogenic couple of importance in metastatic colorectal cancer. Results from the Nordic ACT trial.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23639441 2013 CASZ1 promotes vascular assembly and morphogenesis through the direct regulation of an EGFL7/RhoA-mediated pathway.
23558933 2013 The expression of Egfl7 in human normal tissues and epithelial tumors.
23404186 2013 Expression of Egfl7 correlates with low-grade invasive lesions in human breast cancer.
23386126 2013 EGFL7 ligates ?v?3 integrin to enhance vessel formation.
23280513 2013 Circulating mRNA for epidermal growth factor-like domain 7 (EGFL7) in maternal blood and early intrauterine growth restriction. A preliminary analysis.
22160377 2012 EGFL7: a unique angiogenic signaling factor in vascular development and disease.
22037871 2011 Egfl7 promotes tumor escape from immunity by repressing endothelial cell activation.
22018271 2011 Heterogeneity and degree of TIMP4, GATA4, SOX18, and EGFL7 gene promoter methylation in non-small cell lung cancer and surrounding tissues.
22013081 2012 Gene expression profiling of placentae from women with early- and late-onset pre-eclampsia: down-regulation of the angiogenesis-related genes ACVRL1 and EGFL7 in early-onset disease.
20953557 2010 miR-126 and miR-126*: new players in cancer.
20947685 2010 Impaired angiogenesis and altered Notch signaling in mice overexpressing endothelial Egfl7.
20837907 2010 Epidermal growth factor-like domain 7 suppresses intercellular adhesion molecule 1 expression in response to hypoxia/reoxygenation injury in human coronary artery endothelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20423846 2010 [miR-126 modulates the expression of epidermal growth factor-like domain 7 in human umbilical vein endothelial cells in vitro].
20213100 2010 Expression and clinical significance of EGFL7 in malignant glioma.
20034472 2010 miR-126 inhibits non-small cell lung cancer cells proliferation by targeting EGFL7.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19824075 2009 Novel role for epidermal growth factor-like domain 7 in metastasis of human hepatocellular carcinoma.
19116145 2009 Epigenetic therapy upregulates the tumor suppressor microRNA-126 and its host gene EGFL7 in human cancer cells.
18521848 2008 Deregulated expression of miR-106a predicts survival in human colon cancer patients.
18193184 2008 Ectopic expression of miR-126*, an intronic product of the vascular endothelial EGF-like 7 gene, regulates prostein translation and invasiveness of prostate cancer LNCaP cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17934064 2008 Epidermal growth factor-like domain 7 protects endothelial cells from hyperoxia-induced cell death.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15085134 2004 The endothelial-cell-derived secreted factor Egfl7 regulates vascular tube formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592969 2003 VE-statin, an endothelial repressor of smooth muscle cell migration.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.