Property Summary

NCBI Gene PubMed Count 31
PubMed Score 61.72
PubTator Score 34.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.300 6.6e-07
cutaneous lupus erythematosus -1.700 5.8e-03
glioblastoma multiforme -1.200 3.4e-13
oligodendroglioma -1.100 4.3e-13
osteosarcoma 1.952 2.1e-09
posterior fossa group A ependymoma 1.900 2.1e-10
adult high grade glioma -1.100 2.5e-02
invasive ductal carcinoma -1.050 5.4e-03
Breast cancer -1.700 1.4e-17
lung carcinoma 1.200 2.6e-12
ovarian cancer -2.700 1.5e-13
pituitary cancer 2.100 5.0e-09

Gene RIF (14)

PMID Text
26687980 Findings suggest that EphrinB3 may be a relevant target for promoting remyelination in demyelinating disease
24615845 Data suggest that fusion of Nipah viruses with host cells is facilitated by two of viral membrane proteins, the G protein and the F protein; G head domain binds to human ephrins B2 and B3 altering conformational density of entire G head domain.
21447033 Ephrin-B3 binds to B lymphocytes, most likely via a non-classical receptor, and induces migration of the memory B cell subpopulation.
21413766 Phosphoproteomic profiling of nonsmall cell lung cancer cells reveals that ephrin B3 regulates pro-survival signaling through Akt1-mediated phosphorylation of the EphA2 receptor.
20925654 evidence for an unknown ephrin-B3-binding cell-surface proteoglycan involved in cellular signalling
20029409 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632560 report the crystal structures of the NiV-G both in its receptor-unbound state and in complex with ephrin-B3, providing, to our knowledge, the first view of a paramyxovirus attachment complex in which a cellular protein is used as the virus receptor
18057206 Transgenic EphB1 and ephrin-B3 cooperatively regulate the proliferation and migration of neural progenitors in the hippocampus
16951161 Immunohistochemistry shows robust staining for phosphorylated ephrin-B and ephrin-B3 in invading glioblastoma cells.
16477309 EphrinB3 is a bona fide alternate receptor for NiV entry, and two residues in the G-H loop of the ephrin B-class ligands are critical determinants of NiV receptor activity.
11920461 expressed differentially in colon carcinoma and normal mucosa specimens and may play a role in progression of colon carcinoma

AA Sequence

MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGP      1 - 70
HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIAT     71 - 140
SDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSN    141 - 210
ATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGG    211 - 280
GGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV              281 - 340
//

Text Mined References (33)

PMID Year Title
26687980 2016 Antibody-mediated neutralization of myelin-associated EphrinB3 accelerates CNS remyelination.
24615845 2014 Discerning intersecting fusion-activation pathways in the Nipah virus using machine learning.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21447033 2011 Ephrin-B3 binds specifically to B lymphocytes in blood and induces migration.
21413766 2011 Phosphoproteomic profiling of NSCLC cells reveals that ephrin B3 regulates pro-survival signaling through Akt1-mediated phosphorylation of the EphA2 receptor.
20925654 2011 Ephrin-B3 binds to a sulfated cell-surface receptor.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18632560 2008 Host cell recognition by the henipaviruses: crystal structures of the Nipah G attachment glycoprotein and its complex with ephrin-B3.
18057206 2007 EphB receptors regulate stem/progenitor cell proliferation, migration, and polarity during hippocampal neurogenesis.
17376907 2007 Identification of Hendra virus G glycoprotein residues that are critical for receptor binding.
16951161 2006 Ephrin-B3 ligand promotes glioma invasion through activation of Rac1.
16477309 2006 Two key residues in ephrinB3 are critical for its use as an alternative receptor for Nipah virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15047175 2004 Intramembrane cleavage of ephrinB3 by the human rhomboid family protease, RHBDL2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383247 2002 Ephrin-B3-EphA4 interactions regulate the growth of specific thalamocortical axon populations in vitro.
11920461 2002 Coexpression of ephrin-Bs and their receptors in colon carcinoma.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10197531 1999 EphrinB ligands recruit GRIP family PDZ adaptor proteins into raft membrane microdomains.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9484836 1998 Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9126477 1997 cDNA cloning, chromosomal localization, and expression pattern of EPLG8, a new member of the EPLG gene family encoding ligands of EPH-related protein-tyrosine kinase receptors.
8808709 1996 Elk-L3, a novel transmembrane ligand for the Eph family of receptor tyrosine kinases, expressed in embryonic floor plate, roof plate and hindbrain segments.