Property Summary

NCBI Gene PubMed Count 33
PubMed Score 64.75
PubTator Score 34.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 2.5e-02
Breast cancer -1.700 1.4e-17
cutaneous lupus erythematosus -1.700 5.8e-03
ependymoma 1.200 8.3e-03
glioblastoma -1.100 2.0e-03
invasive ductal carcinoma -1.050 5.4e-03
lung carcinoma 1.200 2.6e-12
malignant mesothelioma 2.300 6.6e-07
oligodendroglioma -1.100 4.3e-13
osteosarcoma 1.900 8.3e-03
ovarian cancer -2.700 1.5e-13
pituitary cancer 2.100 5.0e-09

Gene RIF (15)

AA Sequence

MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGP      1 - 70
HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIAT     71 - 140
SDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSN    141 - 210
ATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGG    211 - 280
GGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV              281 - 340
//

Text Mined References (35)

PMID Year Title