Property Summary

NCBI Gene PubMed Count 104
PubMed Score 268.00
PubTator Score 192.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis 1.022 2.8e-04
malignant mesothelioma -1.800 1.2e-07
astrocytic glioma -2.000 3.6e-03
oligodendroglioma -2.000 3.2e-02
Barrett's esophagus 1.700 7.2e-03
esophageal adenocarcinoma 1.600 2.5e-02
psoriasis -1.600 4.5e-12
group 4 medulloblastoma -3.100 3.0e-07
cystic fibrosis -1.531 3.1e-06
primary pancreatic ductal adenocarcinoma 2.566 1.5e-02
intraductal papillary-mucinous adenoma (... 2.700 6.9e-04
intraductal papillary-mucinous carcinoma... 2.200 5.4e-03
intraductal papillary-mucinous neoplasm ... 2.800 1.7e-02
lung cancer -1.900 2.1e-04
pancreatic cancer 2.400 1.3e-02
lung adenocarcinoma -1.400 1.9e-12
aldosterone-producing adenoma -1.045 4.0e-02
Breast cancer -1.400 6.0e-04
lung carcinoma -1.500 2.7e-07
non-small cell lung carcinoma -1.100 7.7e-13
breast carcinoma -1.100 2.7e-14
spina bifida -2.139 5.0e-02
Pick disease 1.500 6.7e-06
mucosa-associated lymphoid tissue lympho... 1.230 3.0e-02
ovarian cancer 1.900 5.9e-03

Gene RIF (72)

PMID Text
26754526 Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals.
26277777 Together, these findings suggest that CCL2, RARRES2 and EFNB2 are host cell factors involved in respiratory syncytial virus replication.
26212082 increased notably in preeclampsia endothelial progenitor cells and placenta
25825759 Molecular recognition of human ephrinB2 cell surface receptor by an emergent African henipavirus.
25807892 EfnB2 is an essential regulator of endothelial cell death and vessel pruning. This regulation depends upon phosphotyrosine-EfnB2 signaling repressing JNK3 activity via STAT1.
25748802 role in maternal spiral artery remodeling in first trimester
25724897 Human ephrin-B2 is poorly cleaved by KLK4 while the homologous mouse is not.
25434750 Results suggest that ephrinB2 may function as a colorectal cancer cells growth stimulator.
24634162 These genes may be potential biomarkers for identification of subclinical lymph node involvement in papillary thyroid carcinoma (PTC)
24615845 Data suggest that fusion of Nipah viruses with host cells is facilitated by two of viral membrane proteins, the G protein and the F protein; G head domain binds to human ephrins B2 and B3 altering conformational density of entire G head domain.
24517927 EphB4 and ephrin B2 play important roles in neovascularization and arteriovenous differentiation/plasticity.
24038947 Despite the negative results of our mutation screening, we still consider EFNB2 an excellent candidate gene for contributing to the development of Anorectal malformations in humans.
23870033 Downregulation of the endothelial genes Notch1 and ephrinB2 in patients with nodular regenerative hyperplasia.
23764850 NNMT expression regulates neurone morphology in vitro via the sequential activation of the EFNB2 and Akt cellular signalling pathways.
23711177 EphB2 and Ephrin-B2 interactions mediate human mesenchymal stem cell suppression of activated T-cells.
23201622 High levels of ephrinB2 over-expression increases the osteogenic differentiation of human mesenchymal stem cells
22446484 Specific Ab-based ephrinB2 targeting may represent an effective therapeutic strategy to be used as an alternative or in combination with existing antiangiogenic drugs for treating patients with cancer and other angiogenesis-related diseases.
22292016 Monoclonal antibody developed in this study may be used as a reagent to probe ephrin-B2 distribution in normal as well as in pathological conditions and to antagonize ephrin-B2 interaction with EphB4 for basic science and therapeutic applications.
22024229 EphrinB2 is an important indicator of poorly differentiated hepatocarcinoma.
22020958 deregulated ephrin-B2 expression interferes with the regulation of the stem cell niche and leads to a shift of the differentiation pathway and may thereby contribute to the acquisition of the metastatic phenotype
21880727 ephrin-B2-EphB4 signaling between PDLF and osteoblasts of the alveolar bone might contribute to osteogenesis at tension sites during orthodontic tooth movement
21632558 Results indicated that the G-H loop of ephrin-B2 was indeed critical for the interaction between ephrin-B2 and Nipah virus-G.
21575518 The expressions of ephrinB2 and EphB4 were significantly higher in NSCLC tissue than in control tissues, and were positively correlated with lymphatic metastasis.
21047731 EphB4/ephrinB2 interactions between tumor cells and endothelial cells identify a mechanism for site-specific metastatic dissemination of tumor cells.
20491587 The data indicate that MSCs expressing Ephrin-B2 represent a novel proangiogenic cell source to promote neovascularization in ischemic tissues.
20483485 The find of this study indicated that EFNB2 gene may be a candidate susceptibility gene for schizophrenia in the Han Chinese population.
20483485 Observational study of gene-disease association. (HuGE Navigator)
20233847 Ephrin-B2 is a potent regulator of endothelial cell behavior, and indicate that the control of cell migration and angiogenesis by ephrins might involve both receptor-dependent and receptor-independent activities.
19875447 The crystal structure of the EphA4 ligand-binding domain in complex with ephrin-B2, is reported.
19728339 ephrin-B2 plays a critical role in glioma invasion
19664212 Our study is the first to provide data on the presence and role of ephrin B2/EphB4 receptors in human chondrocytes/cartilage
19356789 Localization of EphnB2 is dominantly in the cancer cells of uterine cervical cancers of all cases given.
19272799 High ephrin-B2 is associated with malignant urogenital tissue.
19108727 Ephrin-B2 signaling influence cell-to cell fusion and virus entry by the ratio between the NiV envelope glycoproteins and surface receptors.
19036148 EB2 is not only necessary but also sufficient to allow the establishment of a productive NiV infection.
19035475 EphB4 receptor activation by ephrin B2 in osteoarthritis subchondral bone could affect abnormal metabolism in this tissue by inhibiting resorption factors and their activities
18957513 EphBR-ephrinB interactions lead to monocyte adhesion and transmigration through the vascular endothelium.
18836096 We demonstrated limited Eph/Ephrin expression; notably, the only ligand highly expressed is EphrinB2 in Kaposi sarcoma
18713744 MMP7 and MMP9-mediated cleavage of EphB2 is induced by receptor-ligand interactions at the cell surface and that this event triggers cell-repulsive responses
18580054 polymorphisms in the EFNB2 gene do not appear to contribute in a substantial way to non-diabetic, diabetic or all-cause ESRD susceptibility in African-Americans
18580054 Observational study of gene-disease association. (HuGE Navigator)
18570897 Platelet-derived growth factor signaling through ephrin-b2 regulates hepatic vascular structure and function.
18488039 crystal structures of both Nipah and Hendra attachment glycoproteins in complex with human EFNB2
18445690 expression of ephrinB2 in adult endothelial cells is up-regulated during arterial remodeling and controlled by cyclic stretch
18300229 The ephrin-B2 ectodomain binds to EphB2 with a K(d) of 22.3 nM to form a tight complex in which the tip of the C-D loop and the C-terminus still remain largely flexible.
18231102 Overexpression of ephrinB2 is associated with tumour advancement of ovarian cancers
17611172 EFNB2 gene expression may be a biological marker and a useful prognostic indicator in patients with oesophageal squamous cell carcinoma.
17380111 Lubrol-RAFTs probably represent the platform for tumor-promoting ephrin-B2-integrin-beta1 interaction, which could become an interesting target for future antitumoral therapies
17204606 EphB/ephrin-B molecules play a role in restricting dental pulp stem cell attachment and migration to maintain Dthesse cells within their stem cell niche under steady-state conditions.
17196593 demonstrates that Eph B4 and Ephrin B2 interaction may play an important role in the oncogenesis and angiogenesis of cervical carcinomas
17167981 High ephrinB2 is associated with carcinogenesis and portal vein tumor thrombus formation in human hepatocellular
17123494 indicate that stimulated lymphocytes express EphrinB2, which has the potential to activate endothelial cells
16867992 The results provide critical information on the EphB4*ephrinB2 protein interfaces and their mode of interaction, which will facilitate development of small molecule compounds inhibiting the EphB4*ephrinB2 interaction as novel cancer therapeutics.
16430858 Dll4 stimulation but not Jagged1 markedly induced ephrinB2 expression
16357318 endothelial cell ephrinB2 expression is controlled by microenvironmental determinants rather than being an intrinsic endothelial cell differentiation marker
16343615 EphB4 and ephrin-B2 are instrumental in the establishment of a functional placental structure and of the utero-placental circulation.
16007075 ephrinB2 is a functional receptor for Nipah virus
15998730 ephrin-B2 was found capable of rendering HeLa-USU cells permissive for Hendra virus and Nipah virus-mediated cell fusion as well as infection by live virus.
15996027 ephrin-B signaling might represent a novel protective mechanism that promotes intestinal epithelial wound healing, with potential impact on epithelial restitution in Crohn disease.
15764601 analysis of binding between the Tyr-phosphorylated human ephrinB2 and Nck2 SH2 domain
15718372 defined the expression patterns of human ephrinB2, EphB4, and EphB2 in normal vessels of neonates (i.e. umbilici) and adults and compared them with those in congenital venous malformations
15471957 Ephrin B2 is an important novel factor in Kaposi sarcoma biology and a potential target for therapy.
15193868 EphB4 and ephrin-B2 molecules, which have specific expression patterns during artery and vein development, respectively, were expressed in the placenta
15126321 in hyperinflammatory lesions, ephrinB2 was predominantly expressed in macrophage-like cells and EphB4 in small venules; syntenin and syndecan-1 were up-regulated in EphB4-positive endothelial cells after stimulation with preclustered ephrinB2
15083195 Overexpression of ephrin-B2 suppresses tumour cell growth and vascular function in an in vivo colon cancer model
14499344 ephrin B2 is present in human retinal endothelial cells and vascular growth may be modulated in the retina through activation of the PI3K pathway.
12734395 These data identify distinct propulsive and repulsive effector functions of endothelial ephrinB2 and EphB4 that mediate spatial positional signals during angiogenesis and vessel assembly.
12206665 The entire cytoplasmic domain of ephrin-B2 and its N-terminal fragment, residues 253-300, lack the ability to fold into a well-defined three dimensional structure and are particularly prone to aggregation.
12136247 Expression profile of this ligand of EPHB2 in gastric cancer
12051776 role of ephrin-B2 in erythropoiesis
11983165 Endogenous ephrin B2 from human umbilical artery endothelial cells activates a kinase that phosphorylates murine GST-ephrin-B1 cytoplasmic domain fusion proteins.
11920461 expressed differentially in colon carcinoma and normal mucosa specimens and may play a role in progression of colon carcinoma

AA Sequence

MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV      1 - 70
GQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNG     71 - 140
SLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDG    141 - 210
NSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGN    211 - 280
NNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV                     281 - 333
//

Text Mined References (108)

PMID Year Title
26754526 2016 Interrogating cellular fate decisions with high-throughput arrays of multiplexed cellular communities.
26277777 2015 Identification of CCL2, RARRES2 and EFNB2 as host cell factors that influence the multistep replication of respiratory syncytial virus.
26268439 2015 p75(NTR)-dependent activation of NF-?B regulates microRNA-503 transcription and pericyte-endothelial crosstalk in diabetes after limb ischaemia.
26212082 2015 The role of Delta-like 4 ligand/Notch-ephrin-B2 cascade in the pathogenesis of preeclampsia by regulating functions of endothelial progenitor cell.
25825759 2015 Molecular recognition of human ephrinB2 cell surface receptor by an emergent African henipavirus.
25807892 2015 EphrinB2 controls vessel pruning through STAT1-JNK3 signalling.
25748802 2015 Ephrin-B2 mediates trophoblast-dependent maternal spiral artery remodeling in first trimester.
25724897 2015 Murine, but not human, ephrin-B2 can be efficiently cleaved by the serine protease kallikrein-4: implications for xenograft models of human prostate cancer.
25434750 2015 Effects of ephrinB2 gene siRNA on the biological behavior of human colorectal cancer cells.
24634162 2015 Overexpression of EphB4, EphrinB2, and epidermal growth factor receptor in papillary thyroid carcinoma: A pilot study.
24615845 2014 Discerning intersecting fusion-activation pathways in the Nipah virus using machine learning.
24517927 2014 Ephrin B2 and EphB4 selectively mark arterial and venous vessels in cerebral arteriovenous malformation.
24038947 2013 De novo 13q deletions in two patients with mild anorectal malformations as part of VATER/VACTERL and VATER/VACTERL-like association and analysis of EFNB2 in patients with anorectal malformations.
23870033 2014 Downregulation of the endothelial genes Notch1 and ephrinB2 in patients with nodular regenerative hyperplasia.
23764850 2013 Nicotinamide N-methyltransferase expression in SH-SY5Y neuroblastoma and N27 mesencephalic neurones induces changes in cell morphology via ephrin-B2 and Akt signalling.
23711177 2013 EphB and Ephrin-B interactions mediate human mesenchymal stem cell suppression of activated T-cells.
23201622 2013 High levels of ephrinB2 over-expression increases the osteogenic differentiation of human mesenchymal stem cells and promotes enhanced cell mediated mineralisation in a polyethyleneimine-ephrinB2 gene-activated matrix.
22446484 2012 Blocking ephrinB2 with highly specific antibodies inhibits angiogenesis, lymphangiogenesis, and tumor growth.
22292016 2012 Novel strategy for selection of monoclonal antibodies against highly conserved antigens: phage library panning against ephrin-B2 displayed on yeast.
22024229 2012 Relationships among differentiation degree, contrast-enhanced ultrasound and the expression of Ephb4/Ephrinb2 in primary hepatocarcinoma.
22020958 2012 Deregulated ephrin-B2 signaling in mammary epithelial cells alters the stem cell compartment and interferes with the epithelial differentiation pathway.
21880727 2011 Strain-dependent up-regulation of ephrin-B2 protein in periodontal ligament fibroblasts contributes to osteogenesis during tooth movement.
21632558 2011 Mutations in the G-H loop region of ephrin-B2 can enhance Nipah virus binding and infection.
21575518 2011 [Relationship between multi-slice spiral CT pulmonary perfusion imaging and the expression of EphB4 and ephrinB2 in non-small cell lung cancer].
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21047731 2010 EphB4 promotes site-specific metastatic tumor cell dissemination by interacting with endothelial cell-expressed ephrinB2.
20491587 2010 Mesenchymal stem cells overexpressing ephrin-b2 rapidly adopt an early endothelial phenotype with simultaneous reduction of osteogenic potential.
20483485 2010 Is the EFNB2 locus associated with schizophrenia? Single nucleotide polymorphisms and haplotypes analysis.
20233847 2010 Ephrin-B2 regulates endothelial cell morphology and motility independently of Eph-receptor binding.
19875447 2010 Structural characterization of the EphA4-Ephrin-B2 complex reveals new features enabling Eph-ephrin binding promiscuity.
19836338 2009 Structural plasticity of eph receptor A4 facilitates cross-class ephrin signaling.
19728339 2010 The phosphorylation of ephrin-B2 ligand promotes glioma cell migration and invasion.
19664212 2009 Treatment with ephrin B2 positively impacts the abnormal metabolism of human osteoarthritic chondrocytes.
19356789 2009 Coexpression of EphB4 and ephrinB2 in tumor advancement of uterine cervical cancers.
19272799 Distribution of EphB4 and EphrinB2 in normal and malignant urogenital tissue.
19108727 2008 Ephrin-B2 expression critically influences Nipah virus infection independent of its cytoplasmic tail.
19036148 2008 Selective receptor expression restricts Nipah virus infection of endothelial cells.
19035475 2008 Activation of the receptor EphB4 by its specific ligand ephrin B2 in human osteoarthritic subchondral bone osteoblasts.
18957513 2008 Involvement of endothelial ephrin-B2 in adhesion and transmigration of EphB-receptor-expressing monocytes.
18836096 2009 The role of Ephs, Ephrins, and growth factors in Kaposi sarcoma and implications of EphrinB2 blockade.
18713744 2008 Ephrin-B2-induced cleavage of EphB2 receptor is mediated by matrix metalloproteinases to trigger cell repulsion.
18580054 2008 Association analysis of the ephrin-B2 gene in African-Americans with end-stage renal disease.
18570897 2008 Platelet-derived growth factor signaling through ephrin-b2 regulates hepatic vascular structure and function.
18488039 2008 Structural basis of Nipah and Hendra virus attachment to their cell-surface receptor ephrin-B2.
18445690 2008 Role of ephrinB2 expression in endothelial cells during arteriogenesis: impact on smooth muscle cell migration and monocyte recruitment.
18300229 2008 NMR structure and dynamics of human ephrin-B2 ectodomain: the functionally critical C-D and G-H loops are highly dynamic in solution.
18231102 2008 Coexpression of EphB4 and ephrinB2 in tumour advancement of ovarian cancers.
17611172 2007 Expression and prognostic significance of EFNB2 and EphB4 genes in patients with oesophageal squamous cell carcinoma.
17380111 2007 Lubrol-RAFTs in melanoma cells: a molecular platform for tumor-promoting ephrin-B2-integrin-beta1 interaction.
17376907 2007 Identification of Hendra virus G glycoprotein residues that are critical for receptor binding.
17336907 2007 Notch signaling is essential for ventricular chamber development.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17204606 2007 EphB/ephrin-B interaction mediates adult stem cell attachment, spreading, and migration: implications for dental tissue repair.
17196593 2007 Expression of Eph B4 and Ephrin B2 in cervical cancer tissues and angiogenesis.
17167981 2006 Correlation of four vascular specific growth factors with carcinogenesis and portal vein tumor thrombus formation in human hepatocellular carcinoma.
17123494 2006 Human leukocytes express ephrinB2 which activates microvascular endothelial cells.
16867992 2006 Structural and biophysical characterization of the EphB4*ephrinB2 protein-protein interaction and receptor specificity.
16477309 2006 Two key residues in ephrinB3 are critical for its use as an alternative receptor for Nipah virus.
16430858 2006 Dll4-selective Notch signaling induces ephrinB2 gene expression in endothelial cells.
16357318 2006 Endothelial ephrinB2 is controlled by microenvironmental determinants and associates context-dependently with CD31.
16343615 Differential expression of the receptor tyrosine kinase EphB4 and its ligand Ephrin-B2 during human placental development.
16007075 2005 EphrinB2 is the entry receptor for Nipah virus, an emergent deadly paramyxovirus.
15998730 2005 Ephrin-B2 ligand is a functional receptor for Hendra virus and Nipah virus.
15996027 2005 Ephrin-B2 is differentially expressed in the intestinal epithelium in Crohn's disease and contributes to accelerated epithelial wound healing in vitro.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15764601 2005 Structural insight into the binding diversity between the Tyr-phosphorylated human ephrinBs and Nck2 SH2 domain.
15745950 2005 Interactions between ephrin-B and metabotropic glutamate 1 receptors in brain tissue and cultured neurons.
15718372 2005 Altered expression patterns of EphrinB2 and EphB2 in human umbilical vessels and congenital venous malformations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471957 2005 Ephrin B2 expression in Kaposi sarcoma is induced by human herpesvirus type 8: phenotype switch from venous to arterial endothelium.
15458844 2004 The complexity of PDZ domain-mediated interactions at glutamatergic synapses: a case study on neuroligin.
15193868 2004 Eph and ephrin expression in normal placental development and preeclampsia.
15126321 2004 Syndecan-1 up-regulated by ephrinB2/EphB4 plays dual roles in inflammatory angiogenesis.
15083195 2004 Effects of overexpression of ephrin-B2 on tumour growth in human colorectal cancer.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15047175 2004 Intramembrane cleavage of ephrinB3 by the human rhomboid family protease, RHBDL2.
14499344 2003 Role of ephrin B2 in human retinal endothelial cell proliferation and migration.
12761826 2003 EphA4 provides repulsive signals to developing cochlear ganglion neurites mediated through ephrin-B2 and -B3.
12734395 2003 Forward EphB4 signaling in endothelial cells controls cellular repulsion and segregation from ephrinB2 positive cells.
12606549 2003 Tyrosine phosphorylation of the well packed ephrinB cytoplasmic beta-hairpin for reverse signaling. Structural consequences and binding properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206665 2002 Solution structure and backbone dynamics of the functional cytoplasmic subdomain of human ephrin B2, a cell-surface ligand with bidirectional signaling properties.
12136247 2002 Expression profile of EFNB1, EFNB2, two ligands of EPHB2 in human gastric cancer.
12051776 2002 A role of EphB4 receptor and its ligand, ephrin-B2, in erythropoiesis.
11983165 2002 EphrinB phosphorylation and reverse signaling: regulation by Src kinases and PTP-BL phosphatase.
11920461 2002 Coexpression of ephrin-Bs and their receptors in colon carcinoma.
11780069 2001 Crystal structure of an Eph receptor-ephrin complex.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10648835 2000 Ephrin-B2 is a candidate ligand for the Eph receptor, EphB6.
10473577 1999 Identification of syntenin as a protein of the apical early endocytic compartment in Madin-Darby canine kidney cells.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10066262 1999 Specification of distinct dopaminergic neural pathways: roles of the Eph family receptor EphB1 and ligand ephrin-B2.
9920925 1999 The carboxyl terminus of B class ephrins constitutes a PDZ domain binding motif.
9883737 1998 PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.
9718367 1998 Cell-type specific and estrogen dependent expression of the receptor tyrosine kinase EphB4 and its ligand ephrin-B2 during mammary gland morphogenesis.
9630219 1998 Molecular distinction and angiogenic interaction between embryonic arteries and veins revealed by ephrin-B2 and its receptor Eph-B4.
9576626 1998 The Eph family receptors and ligands.
9533549 1998 Overexpression of Lerk-5/Eplg5 messenger RNA: a novel marker for increased tumorigenicity and metastatic potential in human malignant melanomas.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8878483 1996 Bidirectional signalling through the EPH-family receptor Nuk and its transmembrane ligands.
8660976 1996 The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3.
8559144 1995 Isolation of LERK-5: a ligand of the eph-related receptor tyrosine kinases.
7833926 1994 Selection of cDNAs using chromosome-specific genomic clones: application to human chromosome 13.
7534404 1995 Molecular cloning of a ligand for the EPH-related receptor protein-tyrosine kinase Htk.