Property Summary

NCBI Gene PubMed Count 73
PubMed Score 197.56
PubTator Score 114.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Congenital diaphragmatic hernia 66
Cleft Lip 141
Abnormality of the rib cage 12
Acquired scoliosis 274
Afro-textured hair 13
Aplasia of nasal tip 1
Asymmetric lower limb shortness 1
Asymmetry of the posterior cranium 19
Axillary pterygia 6
Bifid nasal tip 4
Bilateral fifth finger clinodactyly 109
Bipartite clavicle 5
Brachycephaly 86
Brachydactyly 154
Broad cranium shape 86
Broad flat nasal bridge 232
Broad hallux 29
Broad hallux phalanx 8
Byzanthine arch palate 194
Central cleft of nose 2
Cleft Palate 265
Cleft palate with cleft lip 23
Cognitive delay 596
Coronal craniosynostosis 14
Cryptorchidism 287
Curvature of little finger 109
Curvature of spine 275
Dental abnormalities 57
Depressed nasal ridge 48
Downward slant of palpebral fissure 158
Dull intelligence 634
Excess nuchal skin 30
Exotropia 35
Facial asymmetry 31
Flattening of cranial vault 19
Flattening of head 19
Flexion contracture of proximal interphalangeal joint 74
Fragile nails 16
Frontal bossing 154
Global developmental delay 596
Hand polydactyly 10
Hypoplasia of corpus callosum 85
Hypoplastic nasal tip 1
Hypotrophic nasal tip 1
Intellectual disability 998
Joint hyperflexibility 76
Joint laxity 52
Kinky hair texture 13
Longitudinal split nail 2
Low intelligence 634
Low posterior hairline 52
Mental Retardation 634
Mental and motor retardation 596
Mental deficiency 634
Midline defect of the nose 2
Muscle hypotonia 562
Nappy hair texture 13
Nasal bridge wide 232
Notched nasal tip 4
Nystagmus 309
Oral cleft 18
Orbital separation excessive 240
Pectus excavatum 100
Penile hypospadias 102
Plagiocephaly 19
Plagiocephaly, Nonsynostotic 19
Poor school performance 634
Pseudoarthrosis of clavicle 5
Rhomboid shaped head 19
Ridged fingernails 4
Ridged nails 14
Sandal gap 24
Sensorineural Hearing Loss (disorder) 281
Shawl scrotum 9
Short neck 139
Short stature 514
Skull malformation 37
Sloping shoulders 21
Small head 366
Sprengel deformity 16
Syndactyly of fingers 48
Syndactyly of the toes 45
Telecanthus 62
Tooth Abnormalities 66
Umbilical hernia 88
Unilateral breast hypoplasia 1
Uranostaphyloschisis 162
WIDOW'S PEAK 6
Wide skull shape 86
Wooly hair 17
X-linked dominant 56
Disease Target Count P-value
lung adenocarcinoma 2627 1.2e-06
malignant mesothelioma 3135 7.1e-06
breast carcinoma 1589 6.6e-04
fibroadenoma 538 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Acrocephalosyndactylia 17 3.484 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.100 6.6e-04
fibroadenoma -1.300 2.3e-03
lung adenocarcinoma -1.300 1.2e-06
malignant mesothelioma -1.500 7.1e-06

Gene RIF (43)

AA Sequence

MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG      1 - 70
RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG     71 - 140
SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE    141 - 210
TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL    211 - 280
SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV        281 - 346
//

Text Mined References (77)

PMID Year Title