Property Summary

NCBI Gene PubMed Count 46
PubMed Score 342.09
PubTator Score 194.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 1.400 1.4e-03
malignant mesothelioma 1.200 1.5e-06
astrocytic glioma -1.800 9.2e-03
oligodendroglioma -1.600 1.6e-02
cutaneous lupus erythematosus -1.200 5.2e-03
psoriasis -2.300 2.3e-05
glioblastoma -3.200 1.7e-06
cystic fibrosis 1.739 7.8e-06
atypical teratoid / rhabdoid tumor -1.800 1.7e-03
group 4 medulloblastoma -2.800 1.2e-05
medulloblastoma, large-cell -2.100 6.5e-05
intraductal papillary-mucinous adenoma (... 2.500 4.6e-03
intraductal papillary-mucinous carcinoma... 2.500 5.8e-03
intraductal papillary-mucinous neoplasm ... 2.800 2.2e-02
lung cancer -1.700 6.7e-05
pancreatic cancer 1.800 1.8e-07
interstitial cystitis -1.700 1.6e-05
lung adenocarcinoma 1.200 4.8e-05
pediatric high grade glioma -2.500 8.7e-06
pilocytic astrocytoma -2.800 3.2e-06
lung carcinoma -2.100 1.7e-28
breast carcinoma -1.100 1.4e-16
Breast cancer -2.300 1.7e-06
ovarian cancer -2.700 2.7e-07

Gene RIF (17)

PMID Text
25993310 the structure of the ligand-binding domain of the EphA3 receptor in complex with its preferred ligand, ephrin-A5, is reported.
25663355 MiR-96 and miR-182 are upregulated in hepatocellular carcinoma and negatively associated with ephrin A5 expression.
25300504 The genetic variations c.668C>T (rs201008479), c.102C>T (rs199980747) and c.-27C>G (rs200187971) may present an additional genetic risk factor for age-related cataract in the Chinese population.
23959867 Data indicate that ephrin-A5 binding directly facilitates the formation of Eph/ephrin clusters by inducing conformational changes in the ligand-binding domain (LBD) of EphA4.
23401654 Transgenic ephrin-A5 plays a critical role in postnatal lens fiber organization to maintain lens transparency: cells in the ephrin-A5-deficient lens are severely disorganized
22860012 EphrinA5, especially ephrinA5S, acts as a tumor suppressor in hepatocarcinogenesis.
22074469 Data suggest that ephrinA5 mRNA/protein levels are reduced in colon adenocarcinoma compared to normal colon tissue; staging/grading indicates that ephrinA5 inhibits colon adenocarcinoma progression via c-Cbl-mediated EGFR ubiquitination/degradation.
22072270 This study presented that EFNA5 showed strong associations with alcohol withdrawal symptoms.
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
19695673 EFNA5 down-regulation is a consistent finding in chondrosarcomas
19270726 ephrinA5 acted as a tumor suppressor in glioma, and its negative regulation of EGFR contributed to the suppressive effects.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18563700 These observations indicate that only a subset of signal transduction pathways is required for ephrin-A5-induced growth cone collapse.
18385452 ephrin-A5-induced cell-morphologic changes of EphA3-positive LK63 pre-B acute lymphoblastic leukemia cells
15901737 analysis of molecular surfaces in ephrin-A5 essential for a functional interaction with EphA3

AA Sequence

MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP      1 - 70
EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIS     71 - 140
SAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRI    141 - 210
PSRLLAILLFLLAMLLTL                                                        211 - 228
//

Text Mined References (47)

PMID Year Title
25993310 2015 Distinctive Structure of the EphA3/Ephrin-A5 Complex Reveals a Dual Mode of Eph Receptor Interaction for Ephrin-A5.
25663355 2016 OncomiR miR-96 and miR-182 promote cell proliferation and invasion through targeting ephrinA5 in hepatocellular carcinoma.
25300504 2014 Mutational screening of EFNA5 in Chinese age-related cataract patients.
23959867 2013 Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23401654 2013 Further analysis of the lens of ephrin-A5-/- mice: development of postnatal defects.
23242526 2013 The ephrin signaling pathway regulates morphology and adhesion of mouse granulosa cells in vitro.
22860012 2012 Peritumoral small ephrinA5 isoform level predicts the postoperative survival in hepatocellular carcinoma.
22074469 2012 EphrinA5 suppresses colon cancer development by negatively regulating epidermal growth factor receptor stability.
22072270 2012 Genome-wide association study identifies 5q21 and 9p24.1 (KDM4C) loci associated with alcohol withdrawal symptoms.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19695673 2009 Down-regulation of ephrin-A5, a gene product of normal cartilage, in chondrosarcoma.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19270726 2009 EphrinA5 acts as a tumor suppressor in glioma by negative regulation of epidermal growth factor receptor.
19036963 2008 A TrkB/EphrinA interaction controls retinal axon branching and synaptogenesis.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18563700 2008 A subset of signal transduction pathways is required for hippocampal growth cone collapse induced by ephrin-A5.
18385452 2008 Elevated protein tyrosine phosphatase activity provokes Eph/ephrin-facilitated adhesion of pre-B leukemia cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17400922 2007 Crystal structure of the human ephrin-A5 ectodomain.
16239146 2005 Adam meets Eph: an ADAM substrate recognition module acts as a molecular switch for ephrin cleavage in trans.
15901737 2005 Three distinct molecular surfaces in ephrin-A5 are essential for a functional interaction with EphA3.
15777695 2005 Characterization of a novel Eph receptor tyrosine kinase, EphA10, expressed in testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107857 2004 Repelling class discrimination: ephrin-A5 binds to and activates EphB2 receptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11870224 2002 Ephrin-A5 induces rounding, blebbing and de-adhesion of EphA3-expressing 293T and melanoma cells by CrkII and Rho-mediated signalling.
11416136 2001 The EphA8 receptor regulates integrin activity through p110gamma phosphatidylinositol-3 kinase in a tyrosine kinase activity-independent manner.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10601038 1999 Compartmentalized signaling by GPI-anchored ephrin-A5 requires the Fyn tyrosine kinase to regulate cellular adhesion.
10531456 1999 Regulation of learning by EphA receptors: a protein targeting study.
10366629 1999 Ephrin-A binding and EphA receptor expression delineate the matrix compartment of the striatum.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9751130 1998 Eph receptor-ligand interactions are necessary for guidance of retinal ganglion cell axons in vitro.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9245480 1997 LERK-7: a ligand of the Eph-related kinases is developmentally regulated in the brain.
9195962 1997 Ligand for EPH-related kinase (LERK) 7 is the preferred high affinity ligand for the HEK receptor.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8661153 1996 The gene encoding LERK-7 (EPLG7, Epl7), a ligand for the Eph-related receptor tyrosine kinases, maps to human chromosome 5 at band q21 and to mouse chromosome 17.
7748564 1995 Cloning of AL-1, a ligand for an Eph-related tyrosine kinase receptor involved in axon bundle formation.