Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.11
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25070915 The present study provides evidence that microglia upregulates endothelial ephrin-A3 and ephrin-A4 to facilitate in vitro angiogenesis of brain endothelial cells, which is mediated by microglia-released TNF-alpha.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
20643727 Observational study of gene-disease association. (HuGE Navigator)
20071790 The cytoplasmic pattern of ephrin A4 could identify a subgroup of primary osteosarcoma patients with a high liability for progression, poor prognosis, and inferior response to chemotherapy.
19828693 EFNA4-EphA2 interactions are involved in Chronic lymphocytic leukemia cell trafficking between blood and the tissues
18819711 CLL B-cells showed a more heterogeneous Eph/EFN profile, specially EFNA4, EphB6 and EphA10. EphB6 and EFNA4 were further related with the clinical course of CLL.
16540516 This provides genetic evidence that Twist1, Msx2 and Efna4 function together in boundary formation and the pathogenesis of coronal synostosis.
12030849 Characterization of the promoter

AA Sequence

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP      1 - 70
ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES     71 - 140
SGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL             141 - 201
//

Text Mined References (31)

PMID Year Title
25070915 2014 Ephrin-A3 and ephrin-A4 contribute to microglia-induced angiogenesis in brain endothelial cells.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22708584 2012 Primer-BLAST: a tool to design target-specific primers for polymerase chain reaction.
20643727 2010 Prevalence and complications of single-gene and chromosomal disorders in craniosynostosis.
20071790 Ephrin A4 expression in osteosarcoma, impact on prognosis, and patient outcome.
19828693 2009 An impaired transendothelial migration potential of chronic lymphocytic leukemia (CLL) cells can be linked to ephrin-A4 expression.
18819711 2009 Expression profile of Eph receptors and ephrin ligands in healthy human B lymphocytes and chronic lymphocytic leukemia B-cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16540516 2006 Cell mixing at a neural crest-mesoderm boundary and deficient ephrin-Eph signaling in the pathogenesis of craniosynostosis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15777695 2005 Characterization of a novel Eph receptor tyrosine kinase, EphA10, expressed in testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209731 2002 Human osteosarcoma expresses specific ephrin profiles: implications for tumorigenicity and prognosis.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
12030849 2002 Characterization of the human ephrin-A4 promoter.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10607706 2000 A splice variant of human ephrin-A4 encodes a soluble molecule that is secreted by activated human B lymphocytes.
10515610 1999 Characterization of ephrin-A1 and ephrin-A4 as ligands for the EphA8 receptor protein tyrosine kinase.
10366629 1999 Ephrin-A binding and EphA receptor expression delineate the matrix compartment of the striatum.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8660976 1996 The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3.
7838529 1995 Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins.