Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.98
PubTator Score 16.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.900 2.4e-07
cutaneous lupus erythematosus -1.300 2.3e-02
posterior fossa group B ependymoma -1.500 8.6e-11
atypical teratoid / rhabdoid tumor -1.400 1.5e-06
glioblastoma -1.300 2.3e-03
medulloblastoma, large-cell -1.500 2.2e-04
adult high grade glioma -1.400 3.3e-05
pilocytic astrocytoma -1.700 4.6e-10

Gene RIF (9)

PMID Text
25955218 Results show that EFNA3 serves as a tumor suppressor in malignant peripheral nerve sheath tumor cells and it may play a critical role in the FAK signaling and VEGF-associated tumor angiogenesis pathway.
25070915 The present study provides evidence that microglia upregulates endothelial ephrin-A3 and ephrin-A4 to facilitate in vitro angiogenesis of brain endothelial cells, which is mediated by microglia-released TNF-alpha.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
19823572 EphA3 mutants with constitutively-released kinase domains efficiently support shedding, even when their kinase is disabled. Our data suggest that this phosphorylation-activated conformational switch of EphA3 directly controls ADAM-mediated shedding.
19204726 Observational study of gene-disease association. (HuGE Navigator)
18417479 MicroRNA-210 modulates endothelial cell response to hypoxia and inhibits the receptor tyrosine kinase ligand Ephrin-A3.
17980912 Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions.
15901737 analysis of molecular surfaces in ephrin-A5 essential for a functional interaction with EphA3
12907451 EphA2/ephrin-A3 interactions may play a role in the localization and network of Langerhans cells in the epithelium and in the regulation of their trafficking.

AA Sequence

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSG      1 - 70
VGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHA     71 - 140
GHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEK    141 - 210
SISGTSPKREHLPLAVGIAFFLMTFLAS                                              211 - 238
//

Text Mined References (29)

PMID Year Title
25955218 2015 Dissecting the roles of Ephrin-A3 in malignant peripheral nerve sheath tumor by TALENs.
25416956 2014 A proteome-scale map of the human interactome network.
25070915 2014 Ephrin-A3 and ephrin-A4 contribute to microglia-induced angiogenesis in brain endothelial cells.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
19823572 2009 Cytoplasmic relaxation of active Eph controls ephrin shedding by ADAM10.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18417479 2008 MicroRNA-210 modulates endothelial cell response to hypoxia and inhibits the receptor tyrosine kinase ligand Ephrin-A3.
17980912 2008 EphA and ephrin-A proteins regulate integrin-mediated T lymphocyte interactions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15901737 2005 Three distinct molecular surfaces in ephrin-A5 are essential for a functional interaction with EphA3.
15777695 2005 Characterization of a novel Eph receptor tyrosine kinase, EphA10, expressed in testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907451 2003 Human dendritic cells express neuronal Eph receptor tyrosine kinases: role of EphA2 in regulating adhesion to fibronectin.
12496762 2003 Control of hippocampal dendritic spine morphology through ephrin-A3/EphA4 signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10516308 1999 A role for the Eph ligand ephrin-A3 in entorhino-hippocampal axon targeting.
10366629 1999 Ephrin-A binding and EphA receptor expression delineate the matrix compartment of the striatum.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8660976 1996 The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3.
7973638 1994 Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.
7838529 1995 Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins.