Property Summary

NCBI Gene PubMed Count 78
PubMed Score 101.51
PubTator Score 122.49

Knowledge Summary

Patent (38,196)

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.103 1.8e-02
Astrocytoma, Pilocytic 1.100 7.7e-04
cutaneous lupus erythematosus -1.500 3.3e-03
Down syndrome 1.100 9.0e-03
intraductal papillary-mucinous adenoma (... 1.200 1.6e-02
intraductal papillary-mucinous carcinoma... 1.800 4.9e-03
intraductal papillary-mucinous neoplasm ... 2.700 1.6e-03
lung cancer -1.100 4.9e-03
lung carcinoma -1.200 5.3e-13
malignant mesothelioma 3.000 2.1e-07
ovarian cancer 1.200 1.0e-02
pancreatic cancer 1.300 6.5e-05
pituitary cancer -1.800 5.5e-06
psoriasis -1.400 3.2e-11
spina bifida -1.599 3.9e-02
ulcerative colitis -2.200 3.5e-07
urothelial carcinoma -1.700 1.3e-03

 IMPC Phenotype (1)

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (40)

AA Sequence

MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILY      1 - 70
LVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRC     71 - 140
LRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP         141 - 205
//

Text Mined References (78)

PMID Year Title