Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.65
PubTator Score 26.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (10)

PMID Text
25383639 EFhd2 is involved in the control of synapse development and maintenance and is linked to dementia.
24917152 The results imply that EFhd2's physiological and/or pathological function could be regulated by its phosphorylation state.
23977092 Swiprosin-1 localizes to microvilli-like membrane protrusions and lamellipodia and exhibits actin-binding activity.
23959172 Swiprosin-1 is involved in regulating the accessibility of F-actin to cofilin through the clustering of F-actin and the activity of Swiprosin-1 is highly dependent on its phosphorylation status at Ser183
23331044 EFhd2 may play an important role in the pathobiology of tau-mediated neurodegeneration.
21965664 the human Shu complex (hSWS1.SWSAP1) has an evolutionarily conserved function in homologous recombination
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19693767 These results suggest that swiprosin-1 is a PKC-beta I/eta-inducible gene and it modulates mast cell activation through NF-kappaB-dependent pathway.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
15274114 Its predominant presence in CD8 lymphocytes suggests that swiprosin-1 may be involved in functions that are important for cytotoxic lymphocytes.

AA Sequence

MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIG      1 - 70
EPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEV     71 - 140
DEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEE    141 - 210
IKAEQEERKKQAEEMKQRKAAFKELQSTFK                                            211 - 240
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25383639 2014 The calcium-binding protein EFhd2 modulates synapse formation in vitro and is linked to human dementia.
24917152 2014 Cdk5 phosphorylation of EFhd2 at S74 affects its calcium binding activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23977092 2013 Swiprosin-1 is a novel actin bundling protein that regulates cell spreading and migration.
23959172 2013 Swiprosin-1 modulates actin dynamics by regulating the F-actin accessibility to cofilin.
23331044 2013 EFhd2 is a novel amyloid protein associated with pathological tau in Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
21269460 2011 Initial characterization of the human central proteome.
21244694 2011 Fraternal twins: Swiprosin-1/EFhd2 and Swiprosin-2/EFhd1, two homologous EF-hand containing calcium binding adaptor proteins with distinct functions.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19693767 2009 Swiprosin-1 is expressed in mast cells and up-regulated through the protein kinase C beta I/eta pathway.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19118655 2009 Comparative proteomics analysis of caspase-9-protein complexes in untreated and cytochrome c/dATP stimulated lysates of NSCLC cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17673920 2007 The novel adaptor protein Swiprosin-1 enhances BCR signals and contributes to BCR-induced apoptosis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15274114 2004 Identification of swiprosin 1 in human lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788997 2002 Identification of specific proteins in different lymphocyte populations by proteomic tools.