Property Summary

NCBI Gene PubMed Count 14
PubMed Score 89.89
PubTator Score 17.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24861485 detection of methylation of PPP1R3C alone or in combination with EFHD1 in plasma DNA showed high sensitivity and specificity in CRC detection, and may be useful detection method for CRC, especially for early-stage CRCs.
20877624 Observational study of gene-disease association. (HuGE Navigator)
12270117 Cloning of novel mouse genes associated with neuronal function, including Efhd1.

AA Sequence

MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA      1 - 70
RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE     71 - 140
DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK    141 - 210
AEQDERKREEEERRLRQAAFQKLKANFNT                                             211 - 239
//

Text Mined References (16)

PMID Year Title
26975899 2016 Identification of EFHD1 as a novel Ca(2+) sensor for mitoflash activation.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24861485 2014 Aberrant promoter methylation of PPP1R3C and EFHD1 in plasma of colorectal cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21244694 2011 Fraternal twins: Swiprosin-1/EFhd2 and Swiprosin-2/EFhd1, two homologous EF-hand containing calcium binding adaptor proteins with distinct functions.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270117 2002 Novel genes cloned from a neuronal cell line newly established from a cerebellum of an adult p53(-/-) mouse.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.