Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.87
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.700 4.5e-02
cutaneous lupus erythematosus -2.300 1.0e-04
ependymoma 1.300 4.3e-06
group 3 medulloblastoma -1.200 1.3e-02
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.7e-02
lung carcinoma -1.400 4.7e-05
medulloblastoma, large-cell -1.400 2.1e-03
nasopharyngeal carcinoma -1.800 5.4e-05
pituitary cancer -1.500 1.4e-03

Gene RIF (9)

AA Sequence

MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPS      1 - 70
WVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPP     71 - 140
PDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPL    141 - 210
RPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLR    211 - 280
RSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRK    281 - 350
VLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFK    351 - 420
KFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKP    421 - 490
GQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQEEGKS    491 - 560
RELKQVFKAADSKHTNMVDYNTFRDILMSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKK    561 - 630
NMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSRFEDSEKQIDYKSFFSALNW    631 - 700
RKNPVPELQPASYLKERCEDVWLGMPSPIPAKYIDYWTFLKDAFGLEEE                         701 - 749
//

Text Mined References (15)

PMID Year Title