Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2890 1.4e-26
lung adenocarcinoma 2716 2.0e-17

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -3.300 2.0e-17
non-small cell lung cancer -1.305 1.4e-26

Gene RIF (1)

AA Sequence

MEPVSTGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRG      1 - 70
AGRLPRADFRALCAVLGLRAEGATTAGQAAGDGNSRDVTPGDAAAELATDGDSDTDEEARLALRAEPPEL     71 - 140
TFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPRRRRRPPCAPGPDSGPDCERVARLEEENSSL    141 - 210
RELVEDLRAALQSSDARCLALQVGLWKSQASTHEMGHGGPEAAVRELRQAQGALAAAEARAGRLRRGQAE    211 - 280
VRRRAEEARQVVLRSLHRVRELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLANPEPGDKSNEP    281 - 350
EDAGTRDPDPTPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLA    351 - 420
RLSSCRGRCDDQTAEKLMTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKV    421 - 490
EENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPA    491 - 560
AILDALHQALAACQLLRRQPSAPASAAAALTNPLLVSC                                    561 - 598
//

Text Mined References (4)

PMID Year Title