Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.48
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 3.5e-03
ependymoma 1.400 5.9e-07
gastric carcinoma -1.100 1.8e-02
glioblastoma 1.400 8.5e-06
group 3 medulloblastoma 1.100 1.7e-02
intraductal papillary-mucinous adenoma (... 1.200 2.9e-02
intraductal papillary-mucinous carcinoma... -1.100 2.5e-02
lung cancer 1.400 1.4e-03
malignant mesothelioma 2.600 1.5e-08
medulloblastoma, large-cell 1.200 1.6e-02
osteosarcoma -2.079 5.5e-08
pancreatic cancer 1.200 9.4e-04
pancreatic carcinoma 1.200 9.4e-04
pituitary cancer 1.800 7.7e-06
primitive neuroectodermal tumor 1.600 7.3e-04

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MLGPGQVRLRPRVWRDKAGGRVADGASGLPPARGSWRETGTGRALGASSPPRPAQGSSSPGIQSGPSSRP      1 - 70
GSPRGAEQAGTPRPRLSLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVL     71 - 140
WGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFE    141 - 210
KFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSLRRPG               211 - 269
//

Text Mined References (7)

PMID Year Title