Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 1.2e-58
psoriasis 6694 1.1e-31
ependymoma 4679 2.8e-14
lung adenocarcinoma 2716 1.5e-07
nasopharyngeal carcinoma 1058 2.4e-07
lung carcinoma 2843 4.4e-05
astrocytic glioma 2597 8.9e-03
chronic rhinosinusitis 512 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.051 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 8.9e-03
Breast cancer -1.200 1.2e-58
chronic rhinosinusitis -1.648 3.5e-02
ependymoma 3.600 2.8e-14
lung adenocarcinoma -1.200 1.5e-07
lung carcinoma -1.800 4.4e-05
nasopharyngeal carcinoma -1.300 2.4e-07
psoriasis -1.100 1.1e-31

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMD      1 - 70
RVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEE     71 - 140
DPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFND    141 - 210
M//

Text Mined References (10)

PMID Year Title