Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.45
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-07
breast carcinoma 1638 3.0e-05
invasive ductal carcinoma 2951 6.6e-04
ductal carcinoma in situ 1745 1.5e-03
oligodendroglioma 2850 2.0e-02
fibroadenoma 559 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.300 3.0e-05
ductal carcinoma in situ -1.100 1.5e-03
fibroadenoma -1.100 2.7e-02
invasive ductal carcinoma -1.100 6.6e-04
oligodendroglioma 1.100 2.0e-02
osteosarcoma 1.347 2.9e-07

Gene RIF (4)

AA Sequence

MGSTLGCHRSIPRDPSDLSHSRKFSAACNFSNILVNQERLNINTATEEELMTLPGVTRAVARSIVEYREY      1 - 70
IGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGSSAQHSPSSLRRDLLAEQQPHHLATAVPLTPRVNIN     71 - 140
TATPAQLMSVRGLSEKMALSIVDFRREHGPFRSVEDLVRMDGINAAFLDRIRHQVFAERSRPPSTHTNGG    141 - 210
LTFTAKPHPSPTSLSLQSEDLDLPPGGPTQIISTRPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPG    211 - 280
VREVVCMTLLENSIKLLAVQELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSSQLQKGAG    281 - 350
YAGFLWDAAAGMELRDAGSQESSPSNGHGKLAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSENPSKNH    351 - 420
SDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNISTKNPQGSKSLD    421 - 490
NIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAEFYTEKDWSKKDAPRNGSGVALER    491 - 560
SEANIKHER                                                                 561 - 569
//

Text Mined References (14)

PMID Year Title