Property Summary

NCBI Gene PubMed Count 12
PubMed Score 66.90
PubTator Score 26.84

Knowledge Summary


No data available


  Disease (2)

Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0


Gene RIF (5)

20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19767754 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18948268 SECIS binding induces a conformational change in SBP2 that recruits eEFSec, which in concert with the Sec incorporation domain gains access to the ribosomal A site

AA Sequence

RQEESAERSEPSQHVVLSLTFKRYVFDTHKRMVQSP                                      561 - 596

Text Mined References (16)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19767754 2009 Genome-wide association and replication studies identify four variants associated with prostate cancer susceptibility.
18948268 2008 A novel protein domain induces high affinity selenocysteine insertion sequence binding and elongation factor recruitment.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229221 2004 Efficiency of mammalian selenocysteine incorporation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10970870 2000 Characterization of mSelB, a novel mammalian elongation factor for selenoprotein translation.