Property Summary

Ligand Count 1
NCBI Gene PubMed Count 56
PubMed Score 25.14
PubTator Score 86.90

Knowledge Summary

Patent (4,179)

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus -1.100 4.3e-03
group 3 medulloblastoma 1.200 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
invasive ductal carcinoma -1.800 6.5e-04
non-small cell lung cancer -1.065 9.2e-18
ovarian cancer 1.700 2.3e-05
psoriasis -1.300 5.5e-35
ulcerative colitis -1.400 2.9e-09

Gene RIF (40)

AA Sequence

MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYYSNLTKSERYS      1 - 70
SSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAVTGEWLDDEVLIKMASQPFGR     71 - 140
GAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIM    141 - 210
QMCIIELKDRPGKPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGD    211 - 280
LYTDPQIHTETGTDFGDGNLGVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTIL    281 - 350
RGTEEKCGSPQVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN    351 - 420
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGRVCVEKWNLLN    421 - 490
SSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFCEKGEEWDQESAVFHLEHAAN    491 - 560
LGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDR    561 - 630
CQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAA    631 - 700
MEAMKGRLANQYYQKAEEAWAQMEE                                                 701 - 725
//

Text Mined References (69)

PMID Year Title