Property Summary

NCBI Gene PubMed Count 63
PubMed Score 911.50
PubTator Score 322.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.151 5.4e-03
Multiple myeloma 1.222 1.1e-02
ependymoma 1.800 1.3e-02
oligodendroglioma 1.800 4.6e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.4e-03
lung cancer 1.400 2.0e-04
ovarian cancer 2.100 3.6e-04
dermatomyositis -1.100 1.2e-03

Gene RIF (29)

PMID Text
25229650 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
25229650 SiRNA-mediated depletion of EEF2 protein inhibits HIV-1 replication and infectivity in human cells
24648518 Data indicate that the accumulation of the cleaved C-terminal small fragment of eukaryotic elongation factor 2 (eEF2) in the nucleus, and C-terminal Src kinase (Csk) could enhance the proteolytic cleavage of eEF2.
24589652 Results indicated that the eEF2 gene is overexpressed in the majority of several types of cancers and plays an oncogenic role in cancer cell growth.
24480285 The expression levels of three putative HA-regulated proteins (TALDO, ANXA1 and EF2) in control, H2O2-, HA- and HA/H2O2-treated OA chondrocytes were verified by Western blotting and the results indeed support the notion that HA acts in anti-oxidation
24377563 High serum eukaryotic elongation factor 2 level is associated with non-small cell lung cancer.
24167567 Thiopental inhibits global protein synthesis by repression of eukaryotic elongation factor 2 and protects from hypoxic neuronal cell death.
23542375 nuclear localization of active eEF-2 depends upon its interaction with p53, as cells lacking p53 contain less active eEF-2 in the nuclear compartment
23184662 EEF2 phosphorylation by cyclin A-cyclin-dependent kinase 2 (CDK2) on a novel site, serine 595 (S595), directly regulates T56 phosphorylation by eEF2K.
23001565 A single amino acid substitution in eukaryotic elongation factor 2 co-segregates with the disease phenotype of spinocerebellar ataxia 26.
22944692 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
22308030 PHD2 modulated eEF2 activity and protein translation under acute hypoxia.
22269896 Burn induces prolonged activation of eEF2K and eEF2 in pediatric patients.
22020937 NH125 induces eEF2 phosphorylation (peEF2) through multiple pathways in cancer cells
21554491 results suggest that eEF2 is an anti-apoptotic marker in lung adenocarcinoma
21132439 Training in the fasted state, compared with identical training with ample carbohydrate intake, facilitates post-exercise dephosphorylation of eEF2.
20708687 eEF-2 is activated by both lithium and GSK-3, whereas, lithium treatment and inhibition of GSK-3 have opposing effects on eEF-2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20181627 melanoma antigen expressed in G361, a representative melanoma cell line/ reacted with autoantibodies in patient sera
19360331 Overexpressed eEF2 in gastrointestinal cancers promoted G2/M progression and enhanced their cell growth in vitro and in vivo.
19275587 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
19036825 Skeletal muscle eEF2 and 4EBP1 phosphorylation during endurance exercise is dependent on intensity and muscle fiber type.
17824250 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
17586317 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
16648488 Hypoxia inhibits protein synthesis through a 4EBP1 and EEF2 pathway controlled by mTOR and unbcoupled in breast cancer cells.
16520893 Data show that overproduction of elongation factor 2 blocks HIV-1 viral protein R-induced cell death both in fission yeast and human cells.
16520893 Treatment of cells with cyclosporine A blocks the interaction of HIV-1 Gag with eEF2, indicating that cyclophilin A (CypA) stabilizes the Gag-eEF2 association
16098202 Levels of p-eEF2K were significantly increased, and total eEF2 significantly decreased in Alzheimer disease
15534876 inhibition of protein synthesis under high pressure occurs independent of the phosphorylation of eEF-2

AA Sequence

MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITI      1 - 70
KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTE     71 - 140
TVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLG    141 - 210
TVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSP    211 - 280
EGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDAL    281 - 350
LQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL    351 - 420
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEH    421 - 490
AHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKD    491 - 560
LEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQ    561 - 630
RARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGV    631 - 700
RFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHV    701 - 770
FEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK    771 - 840
RKGLKEGIPALDNFLDKL                                                        841 - 858
//

Text Mined References (76)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25231979 2014 Identification and characterization of a novel evolutionarily conserved lysine-specific methyltransferase targeting eukaryotic translation elongation factor 2 (eEF2).
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25064856 2014 Homodimerization of RBPMS2 through a new RRM-interaction motif is necessary to control smooth muscle plasticity.
24648518 2014 C-terminal Src kinase (Csk)-mediated phosphorylation of eukaryotic elongation factor 2 (eEF2) promotes proteolytic cleavage and nuclear translocation of eEF2.
24589652 2014 The translation elongation factor eEF2 is a novel tumor?associated antigen overexpressed in various types of cancers.
24480285 2014 Proteomic analysis of osteoarthritic chondrocyte reveals the hyaluronic acid-regulated proteins involved in chondroprotective effect under oxidative stress.
24377563 2014 Clinical value of eukaryotic elongation factor 2 (eEF2) in non-small cell lung cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167567 2013 Thiopental inhibits global protein synthesis by repression of eukaryotic elongation factor 2 and protects from hypoxic neuronal cell death.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23823123 2013 Systematic Analysis Reveals Elongation Factor 2 and ?-Enolase as Novel Interaction Partners of AKT2.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23542375 2013 Molecular control of the amount, subcellular location, and activity state of translation elongation factor 2 in neurons experiencing stress.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184662 2013 Phosphorylation of eukaryotic elongation factor 2 (eEF2) by cyclin A-cyclin-dependent kinase 2 regulates its inhibition by eEF2 kinase.
23001565 2012 A conserved eEF2 coding variant in SCA26 leads to loss of translational fidelity and increased susceptibility to proteostatic insult.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22308030 2012 Prolyl hydroxylase-dependent modulation of eukaryotic elongation factor 2 activity and protein translation under acute hypoxia.
22269896 2012 Thermal injury activates the eEF2K-dependent eEF2 pathway in pediatric patients.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22020937 2011 1-Benzyl-3-cetyl-2-methylimidazolium iodide (NH125) induces phosphorylation of eukaryotic elongation factor-2 (eEF2): a cautionary note on the anticancer mechanism of an eEF2 kinase inhibitor.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21554491 2011 Sumoylation of eukaryotic elongation factor 2 is vital for protein stability and anti-apoptotic activity in lung adenocarcinoma cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21132439 2011 Training in the fasted state facilitates re-activation of eEF2 activity during recovery from endurance exercise.
20708687 2010 Identification of eukaryotic elongation factor-2 as a novel cellular target of lithium and glycogen synthase kinase-3.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20181627 Identification of melanoma antigens using a Serological Proteome Approach (SERPA).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19360331 2009 Overexpression of eukaryotic elongation factor eEF2 in gastrointestinal cancers and its involvement in G2/M progression in the cell cycle.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19036825 2009 Skeletal muscle eEF2 and 4EBP1 phosphorylation during endurance exercise is dependent on intensity and muscle fiber type.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16648488 2006 Hypoxia inhibits protein synthesis through a 4E-BP1 and elongation factor 2 kinase pathway controlled by mTOR and uncoupled in breast cancer cells.
16520893 2006 Suppressive effect of elongation factor 2 on apoptosis induced by HIV-1 viral protein R.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
16098202 2005 Levels of mTOR and its downstream targets 4E-BP1, eEF2, and eEF2 kinase in relationships with tau in Alzheimer's disease brain.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15635413 2005 Nucleolar proteome dynamics.
15534876 2005 High hydrostatic pressure inhibits the biosynthesis of eukaryotic elongation factor-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15189156 2004 The molecular mechanics of eukaryotic translation.
14594813 2004 Characterization of the protein kinase activity of TRPM7/ChaK1, a protein kinase fused to the transient receptor potential ion channel.
12891704 2003 Cytoplasmic complex of p53 and eEF2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
8386634 1993 Regulation of elongation factor-2 by multisite phosphorylation.
8318952 1993 Study of localization of the protein-synthesizing machinery along actin filament bundles.
6427766 1984 Chromosomal assignment of the gene for human elongation factor 2.
3693353 1987 Identification of the major Mr 100,000 substrate for calmodulin-dependent protein kinase III in mammalian cells as elongation factor-2.
3034518 1987 Regional assignment of five genes on human chromosome 19.
2840927 1988 Cloning and sequence analysis of a cDNA from human ovarian granulosa cells encoding the C-terminal part of human elongation factor 2.
2610926 1989 Complete sequence of the coding region of human elongation factor 2 (EF-2) by enzymatic amplification of cDNA from human ovarian granulosa cells.
2318846 1990 Kinetic determination of the effects of ADP-ribosylation on the interaction of eukaryotic elongation factor 2 with ribosomes.
1596361 1992 Construction of a plasmid containing the complete coding region of human elongation factor 2.