Property Summary

Ligand Count 3
NCBI Gene PubMed Count 158
PubMed Score 1183.03
PubTator Score 427.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.575 5.3e-08
adrenocortical carcinoma -1.154 1.0e-04
Astrocytoma, Pilocytic 1.200 8.7e-04
Breast cancer -1.900 2.5e-11
breast carcinoma -1.100 2.1e-22
cystic fibrosis 1.004 2.2e-04
ependymoma 1.400 5.0e-08
group 3 medulloblastoma 1.800 1.5e-03
intraductal papillary-mucinous adenoma (... -1.500 3.0e-03
intraductal papillary-mucinous carcinoma... -1.500 3.1e-02
intraductal papillary-mucinous neoplasm ... -3.000 1.9e-03
invasive ductal carcinoma -1.353 1.5e-04
medulloblastoma, large-cell 2.000 1.5e-03
non-small cell lung cancer -1.193 4.1e-08
osteosarcoma -1.062 1.7e-02
ovarian cancer -2.700 1.0e-08
pancreatic cancer -1.200 1.2e-02
primitive neuroectodermal tumor 1.200 1.7e-02

Protein-protein Interaction (9)

Gene RIF (96)

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW    141 - 210
FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF    211 - 280
APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP    281 - 350
GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP    351 - 420
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK                                421 - 462
//

Text Mined References (163)

PMID Year Title